EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01250 - Ribosomal_S6)
FAM  PF01250
PID  Ribosomal_S6
DES  Ribosomal protein S6
IPR  IPR000529
ANO  12
ALN  92
AID  0.303291
APH  ((((RS6_MYCLE/2-93:0.64634,(((RR6_ODOSI/5-96:1.14083,((RR6_PORPU/13-104:0.71204,RR6_CYAPA/13-104:0.66299):0.12693,RS6_SYNY3/4-95:0.43002):0.19190):0.21571,RS6_BACSU/2-93:0.61431):0.16018,RS6_HELPY/2-93:0.56094):0.08918):0.19131,(RS6_ECOLI/2-92:0.06077,RS6_HAEIN/2-92:0.10568):0.60790):0.17009,RS6_THETH/2-93:0.76434):1.23738,RS6_MYCGE/1-90:0.24741,RS6_MYCPN/1-90:0.09788);
ATP  ((((RS6_MYCLE/2-93,(((RR6_ODOSI/5-96,((RR6_PORPU/13-104,RR6_CYAPA/13-104),RS6_SYNY3/4-95)),RS6_BACSU/2-93),RS6_HELPY/2-93)),(RS6_ECOLI/2-92,RS6_HAEIN/2-92)),RS6_THETH/2-93),RS6_MYCGE/1-90,RS6_MYCPN/1-90);
ATL  9.016
DNO  12
DLN  276
DID  0.429515
DPH  (((RR6_CYAPA/13-104:0.39913,(RR6_ODOSI/5-96:0.58828,RR6_PORPU/13-104:0.43013):0.10979):0.08130,(RS6_SYNY3/4-95:0.29990,((((RS6_ECOLI/2-92:0.04039,RS6_HAEIN/2-92:0.29188):0.34811,(RS6_MYCLE/2-93:0.27182,RS6_THETH/2-93:0.51300):0.16886):0.10392,RS6_HELPY/2-93:0.36868):0.07136,RS6_BACSU/2-93:0.44162):0.20921):0.14026):0.61739,RS6_MYCGE/1-90:0.18595,RS6_MYCPN/1-90:0.18275);
DTP  (((RR6_CYAPA/13-104,(RR6_ODOSI/5-96,RR6_PORPU/13-104)),(RS6_SYNY3/4-95,((((RS6_ECOLI/2-92,RS6_HAEIN/2-92),(RS6_MYCLE/2-93,RS6_THETH/2-93)),RS6_HELPY/2-93),RS6_BACSU/2-93))),RS6_MYCGE/1-90,RS6_MYCPN/1-90);
DTL  5.86373
RID  0.303291
RPH  ((((RS6_MYCLE/2-93:0.64634,(((RR6_ODOSI/5-96:1.14083,((RR6_PORPU/13-104:0.71204,RR6_CYAPA/13-104:0.66299):0.12693,RS6_SYNY3/4-95:0.43002):0.19190):0.21571,RS6_BACSU/2-93:0.61431):0.16018,RS6_HELPY/2-93:0.56094):0.08918):0.19131,(RS6_ECOLI/2-92:0.06077,RS6_HAEIN/2-92:0.10568):0.60790):0.17009,RS6_THETH/2-93:0.76434):1.23738,RS6_MYCGE/1-90:0.24741,RS6_MYCPN/1-90:0.09788);
RTP  ((((RS6_MYCLE/2-93,(((RR6_ODOSI/5-96,((RR6_PORPU/13-104,RR6_CYAPA/13-104),RS6_SYNY3/4-95)),RS6_BACSU/2-93),RS6_HELPY/2-93)),(RS6_ECOLI/2-92,RS6_HAEIN/2-92)),RS6_THETH/2-93),RS6_MYCGE/1-90,RS6_MYCPN/1-90);
RTL  9.016
LNK  RR6_CYAPA/13-104:P48134:U30821
LNK  RR6_ODOSI/5-96:P49494:Z67753
LNK  RR6_PORPU/13-104:P51359:U38804
LNK  RS6_BACSU/2-93:P21468:D26185
LNK  RS6_ECOLI/2-92:P02358:X04022
LNK  RS6_HAEIN/2-92:P44375:U32736
LNK  RS6_HELPY/2-93:P56013:AE000630
LNK  RS6_MYCGE/1-90:P47336:U39689
LNK  RS6_MYCLE/2-93:P46389:L39923
LNK  RS6_MYCPN/1-90:P75543:AE000058
LNK  RS6_SYNY3/4-95:P73636:D90908
LNK  RS6_THETH/2-93:P23370:AF146075
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RS6_THETH/2-93
ASQ  RRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKS
DSQ  CGCAGGTACGAGGTGAACATCGTCCTGAACCCCAACCTGGACCAGAGCCAGCTCGCCCTGGAGAAGGAGATCATCCAGCGGGCTCTGGAGAACTACGGCGCCCGCGTGGAGAAGGTGGAGGAGCTGGGGCTTCGCCGCCTGGCCTACCCCATCGCCAAGGACCCCCAGGGCTACTTCCTCTGGTACCAGGTGGAGATGCCCGAGGACCGGGTGAACGACCTGGCCCGGGAGCTCCGCATCCGGGACAACGTGCGCCGGGTCATGGTGGTGAAGTCC
TRN  10010101100011011
NAM  RS6_MYCLE/2-93
ASQ  RPYEIMVILDPTLDECTVGPSLETFLNVVRKDGGAIDKVDIWGRRRLAYEISKHAEGIYVVIDLKAAPATVSELDRQLSLNESVLRTKVMRT
DSQ  CGTCCATACGAAATCATGGTCATTCTTGACCCCACGCTCGACGAGTGCACTGTCGGTCCGTCTTTGGAGACGTTCCTCAACGTCGTCCGCAAGGACGGTGGAGCTATCGATAAGGTCGACATCTGGGGTCGGCGCCGGCTGGCCTACGAGATCTCCAAGCACGCTGAAGGCATCTACGTTGTCATTGATCTGAAGGCTGCGCCGGCAACGGTATCCGAGCTTGACCGCCAGCTCAGCCTCAACGAGTCGGTGTTGCGCACCAAGGTAATGCGCACT
TRN  11011111101111111
NAM  RS6_HELPY/2-93
ASQ  RHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKAEPSMIVELERLYRINEDVLRFIVIKY
DSQ  AGGCATTATGAAACGATGTTTATTCTCAAACCTACTTTAGTAGAAGAAGAGATTAAATCCAAGATTGAGTTTTATAAAGAAGTGATCACTAAGCATCACGGCGTGATTGAAACGAGCCTGGATATGGGCATGCGTAATTTAGCTTATGAAATCAAAAAGCACAAAAGAGGCTATTATTATGTGGCGTATTTCAAAGCGGAGCCGTCAATGATTGTAGAGCTTGAACGATTGTATCGCATCAATGAAGACGTGTTGCGTTTCATTGTGATCAAATAC
TRN  10010101100011000
NAM  RS6_BACSU/2-93
ASQ  RKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFYQIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKE
DSQ  AGAAAGTACGAAGTTATGTACATTATCCGCCCAAACATTGACGAAGAGTCTAAAAAAGCAGTTATCGAGCGTTTCAACAACGTTCTGACTTCTAACGGTGCGGAGATCACTGGAACAAAGGATTGGGGTAAACGTCGTCTTGCTTACGAAATCAACGATTTCCGCGACGGTTTCTACCAAATCGTAAACGTTCAATCTGACGCTGCGGCAGTTCAAGAATTTGACCGTCTAGCTAAGATCAGTGACGATATCATTCGCCACATTGTTGTTAAAGAA
TRN  10010101100011011
NAM  RS6_HAEIN/2-92
ASQ  RHYEIVFMVHP-DQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQQVIDELETTFRYNDAVLRSLVIHT
DSQ  CGTCACTACGAAATCGTGTTTATGGTTCATCCG---GACCAAAGCGAGCAAGTACCAGGTATGATCGAACGTTACACCGGTTCTGTAAAAGAAGCTGGTGGTCAAGTTCATCGCCTAGAAGATTGGGGTCGTCGCCAATTAGCGTACCCAATTAATAAATTACACAAAGCACATTATGTGCTTATGAATGTAGAAGCGCCTCAACAAGTCATCGACGAGCTAGAAACGACTTTCCGTTATAACGATGCTGTATTACGCAGTCTTGTTATCCATACT
TRN  11011101111011010
NAM  RS6_ECOLI/2-92
ASQ  RHYEIVFMVHP-DQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRT
DSQ  CGTCATTACGAAATCGTTTTTATGGTCCATCCT---GATCAGAGCGAACAGGTTCCGGGCATGATCGAGCGCTACACTGCTGCCATCACTGGTGCAGAAGGCAAGATCCACCGTCTGGAAGACTGGGGCCGCCGTCAGCTGGCTTACCCGATCAACAAACTGCACAAAGCACACTACGTTTTGATGAATGTTGAAGCTCCGCAGGAAGTGATCGATGAGCTGGAAACTACCTTCCGCTTCAACGATGCCGTTATCCGCAGCATGGTTATGCGTACC
TRN  11011101101011011
NAM  RS6_SYNY3/4-95
ASQ  NSYELMVILRPDLNEERVSQEVTKYQEFLTNNAAEEVSVKVWGKRRLAYQIRRFNDGIYVLFNFNGEGQQIALIERDMRLNDNVMRFLSIKL
DSQ  AATAGTTACGAACTGATGGTAATTCTCCGTCCCGACCTGAATGAAGAACGGGTTAGCCAAGAAGTTACCAAATACCAAGAATTTTTGACCAACAATGCCGCCGAAGAAGTATCGGTGAAGGTTTGGGGTAAACGCCGTCTAGCTTACCAAATCCGTCGCTTTAACGATGGCATTTATGTTTTGTTCAACTTCAACGGTGAAGGCCAGCAGATTGCTTTAATTGAACGGGATATGCGTCTTAACGATAATGTGATGCGCTTTTTGAGCATTAAGCTC
TRN  11011101101011010
NAM  RR6_CYAPA/13-104
ASQ  ITYRTTYILKPSLTEEEITKEIEDYQKLLIDNGAEDIIIENTGKCRLAYLINKQNDGIYFQITYRGANTLVNILQRRMRLSINTLRYQTFKV
DSQ  ATAACTTATCGTACTACTTATATTCTTAAACCAAGTTTAACTGAAGAAGAAATTACTAAAGAAATTGAAGATTATCAAAAATTATTAATTGATAATGGTGCTGAAGATATTATTATTGAAAATACTGGTAAATGTAGATTAGCCTATTTAATAAACAAACAAAATGATGGTATCTACTTTCAAATAACATATCGTGGTGCAAATACACTAGTAAATATTTTACAACGTCGAATGCGCTTAAGTATTAATACTTTACGTTATCAAACTTTTAAAGTA
TRN  10010101110011010
NAM  RR6_PORPU/13-104
ASQ  NWYETVYLIKSDLNEDRTLCIINEYKSMLTNGGAKNIILQHRGRRHLSYSIKDYRDGIYVQVNYEGNGKLVQSFEKSLRFDENIIRYLTNKQ
DSQ  AATTGGTATGAAACTGTTTATTTAATAAAATCCGATTTGAACGAAGACAGGACTCTATGTATAATAAATGAATACAAAAGTATGCTAACCAATGGTGGAGCTAAAAATATCATTCTACAACATAGAGGTAGAAGACATCTGAGTTATTCTATTAAAGATTATAGAGATGGTATTTATGTACAAGTCAATTATGAAGGAAATGGGAAACTTGTTCAATCTTTTGAAAAGTCGTTAAGATTTGATGAAAATATTATTAGGTATTTAACAAATAAGCAG
TRN  10010101100011010
NAM  RS6_MYCPN/1-90
ASQ  MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQT--EYLGLKELAYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINL
DSQ  ATGCAATACAACATTATTCTTTTAGTTGATGGTTCGCTCTCGTTAGAGCAAGCTAACCAAGTGAATGAAAAACAACAGCAAACGTTAACCAACGTTGAGGGTTTGCAAACA------GAATACCTTGGTTTAAAGGAGTTGGCATACCCAATTAAGAAACAACTCTCAGCGCATTATTACCGCTGGAAGTTTAGTGGTGATAACCAATCCACGAAGGACTTTAAGCGTACCGCTAACATTAACAAGCAAGTATTACGTGAACTGATTATTAACTTA
TRN  11011101101011000
NAM  RS6_MYCGE/1-90
ASQ  MHYNIILLVDGTLSLEQANQVEQKHQKLLEKATEFKS--EYLGLKELAYPIKKQLSAHYYRWSFHGESNCTKEFKRAANINKQIIRELIINR
DSQ  ATGCACTACAATATCATTCTTTTAGTTGATGGTACGCTTAGTTTAGAACAAGCTAACCAAGTTGAACAAAAACACCAAAAATTGCTTGAAAAGGCAACTGAATTTAAAAGT------GAATACTTAGGTTTAAAAGAGTTGGCTTACCCCATTAAAAAGCAACTTTCTGCTCACTATTACAGATGGAGTTTTCATGGTGAAAGCAATTGTACTAAGGAGTTTAAAAGAGCTGCTAACATCAATAAGCAGATAATAAGAGAGTTAATTATTAACAGA
TRN  10010101110011010
NAM  RR6_ODOSI/5-96
ASQ  KKYEMMILLTEEFNDSELKTWAFNYAKALRKLSASEISVISRGKRDLSYYINNQKKGNFIQINFSSMPKYVDNFSKNLKFDSNVLRFLILNK
DSQ  AAAAAATATGAAATGATGATTCTTTTAACTGAAGAATTTAATGATAGCGAATTAAAGACTTGGGCATTTAATTATGCAAAAGCTTTAAGAAAATTAAGTGCTTCAGAAATATCTGTAATTTCTCGTGGAAAACGTGATTTATCGTATTATATTAATAACCAAAAAAAAGGAAACTTTATTCAAATAAATTTTTCAAGCATGCCTAAATATGTCGATAATTTTTCAAAAAATTTAAAATTTGATTCCAATGTTTTAAGATTTTTGATTTTAAATAAA
TRN  10010101110011000
//