EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01246 - Ribosomal_L24e)
FAM  PF01246
PID  Ribosomal_L24e
DES  Ribosomal protein L24e
IPR  IPR000988
ANO  7
ALN  71
AID  0.424461
APH  ((RL24_RAT/1-71:0.33513,RL24_KLULA/1-71:0.29099):0.08534,(RL24_ARATH/3-73:0.05291,RL24_HORVU/3-73:0.10341):0.36106,((RL24E_HALMA/1-66:0.66612,RL24E_METJA/2-70:0.32411):0.51243,RLP24_SCHPO/1-71:0.44805):0.33322);
ATP  ((RL24_RAT/1-71,RL24_KLULA/1-71),(RL24_ARATH/3-73,RL24_HORVU/3-73),((RL24E_HALMA/1-66,RL24E_METJA/2-70),RLP24_SCHPO/1-71));
ATL  3.51277
DNO  6
DLN  213
DID  0.521403
DPH  ((RL24_KLULA/1-71:0.29405,(RL24E_METJA/2-70:0.53712,RLP24_SCHPO/1-71:0.39651):0.19965):0.07746,(RL24_ARATH/3-73:0.12654,RL24_HORVU/3-73:0.18060):0.17688,RL24_RAT/1-71:0.35045);
DTP  ((RL24_KLULA/1-71,(RL24E_METJA/2-70,RLP24_SCHPO/1-71)),(RL24_ARATH/3-73,RL24_HORVU/3-73),RL24_RAT/1-71);
DTL  2.33926
RID  0.461431
RPH  ((RL24_RAT/1-71:0.33432,RL24_KLULA/1-71:0.29813):0.10043,(RL24_ARATH/3-73:0.05430,RL24_HORVU/3-73:0.10418):0.35871,(RL24E_METJA/2-70:0.82290,RLP24_SCHPO/1-71:0.44154):0.34603);
RTP  ((RL24_RAT/1-71,RL24_KLULA/1-71),(RL24_ARATH/3-73,RL24_HORVU/3-73),(RL24E_METJA/2-70,RLP24_SCHPO/1-71));
RTL  2.86055
LNK  RL24_ARATH/3-73:P38666:AL132969
LNK  RL24E_HALMA/1-66:P14116:
LNK  RL24E_METJA/2-70:P54064:U67562
LNK  RL24_HORVU/3-73:P50888:X94296
LNK  RL24_KLULA/1-71:P38665:L05777
LNK  RL24_RAT/1-71:P83732:X78443
LNK  RLP24_SCHPO/1-71:Q10353:Z70043
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RLP24_SCHPO/1-71
ASQ  MRVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHKNFKMKRNPRKVAWTKAYRKAHGKEMVYDTALAV
DSQ  ATGAGGGTACATACTTGCTATTTCTGCTCGGGTCCTGTTTACCCAGGACATGGAATAATGTTTGTTAGAAATGACTCCAAGGTCTTTCGTTTCTGTCGCAGCAAGTGCCATAAGAACTTCAAAATGAAGCGCAATCCTCGTAAGGTTGCTTGGACCAAAGCGTACCGTAAGGCACATGGAAAGGAAATGGTTTATGACACAGCTCTCGCAGTT
TRN  10010101110011011
NAM  RL24_KLULA/1-71
ASQ  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRRHHKKGITEEVARKR
DSQ  ATGAAGGTCGAAATTGATTCCTTTTCCGGTGCTAAGATTTACCCAGGTAGAGGTACCTTGTTTGTCCGTGGTGACTCCAAGATCTTCAGATTCCAATCTTCCAAGTCCGCTTCTTTGTTCCACCAAAGAAAGAACCCAAGAAGAATTGCTTGGACTGTCTTGTACAGAAGACACCACAAGAAGGGTATCACTGAAGAAGTTGCCAGAAAGAGA
TRN  10110101110011011
NAM  RL24_RAT/1-71
ASQ  MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKR
DSQ  ATGAAGGTCGAGCTGTGCAGTTTTAGTGGGTACAAGATCTACCCGGGACACGGGCGGCGCTACGCCAGGACCGATGGGAAGGTTTTCCAGTTTCTTAATGCCAAATGTGAGTCCGCATTCCTTTCCAAAAGGAACCCTCGGCAAATTAACTGGACTGTCCTCTACAGAAGAAAACACAAGAAAGGACAGTCGGAAGAAATTCAAAAGAAAAGA
TRN  10010101100011011
NAM  RL24_HORVU/3-73
ASQ  LKTELCRFSGQKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPAKLCWTAMYRKQHKKDIHAEAAKKR
DSQ  CTGAAGACTGAGCTTTGCCGTTTTAGCGGCCAGAAGATTTACCCAGGGAAGGGTATCAGGTTCATTCGTTCAGATTCACAGGTTTTCCTCTTTGCCAACTCAAAATGCAAGCGCTACTTCCACAACCGCCTGAAGCCTGCAAAGCTTTGCTGGACAGCAATGTACAGGAAGCAGCACAAGAAGGACATCCATGCTGAGGCTGCCAAGAAGAGG
TRN  10010101100011001
NAM  RL24_ARATH/3-73
ASQ  LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLAWTAMYRKQHKKDAAQEAVKRR
DSQ  CTCAAGACGGAGCTTTGTCGTTTCAGTGGACAGAAGATTTACCCAGGAAGAGGAATTAGGTTTATCCGATCTGATTCTCAGGTTTTCTTGTTTCTTAACTCAAAATGTAAGAGGTACTTCCATAACAAGTTGAAGCCATCCAAGCTTGCATGGACTGCCATGTACAGAAAGCAACACAAGAAGGATGCAGCACAAGAGGCTGTGAAGAGAAGG
TRN  10010101110011001
NAM  RL24E_METJA/2-70
ASQ  PEWRTCSFCGYEIEPGKGKMVVEKDGTVLYFCSSKCEKSYRMGRNPRKLKWTKVY--QDMKAELKKAQESQ
DSQ  CCAGAATGGAGAACATGCAGCTTTTGTGGTTATGAAATTGAGCCAGGAAAAGGAAAAATGGTCGTAGAAAAAGATGGGACTGTATTATATTTCTGCTCATCCAAATGTGAGAAAAGCTACAGAATGGGAAGAAATCCAAGAAAATTAAAATGGACTAAAGTCTAT------CAAGATATGAAGGCAGAGTTAAAGAAAGCTCAAGAATCACAA
TRN  10110101110011000
NAM  RL24E_HALMA/1-66
ASQ  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDT-----ARGEAGEAEDEA
//