EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01232 - Mannitol_dh)
FAM  PF01232
PID  Mannitol_dh
DES  Mannitol dehydrogenase rossman domain
IPR  IPR000669
ANO  16
ALN  172
AID  0.277924
APH  (((((((UXUB_ECOLI/23-188:0.32240,YDFI_ECOLI/22-185:0.41304):0.11025,YEIQ_ECOLI/25-188:0.30424):0.17928,(UXAB_ECOLI/16-173:1.60023,(((MTLD_ECOLI/1-123:0.46027,(MTLD_ENTFA/1-125:0.22978,MTLD_STRMU/2-126:0.23497):0.15765):0.08363,(MTLD_BACSU/1-122:0.33346,MTLD_BACST/1-124:0.30288):0.17872):0.05067,(MTLD_CLOAB/1-123:0.53574,MTLD_MYCPN/4-118:0.94100):0.11224):1.25289):0.28937):0.13296,YEI0_YEAST/36-200:0.45321):0.18984,O08355_PSEFL/27-192:0.29740):0.15942,DALD_KLEPN/5-166:1.10825):0.23318,O68111_RHOCA/17-181:0.23986,MTLK_RHOSH/16-179:0.14271);
ATP  (((((((UXUB_ECOLI/23-188,YDFI_ECOLI/22-185),YEIQ_ECOLI/25-188),(UXAB_ECOLI/16-173,(((MTLD_ECOLI/1-123,(MTLD_ENTFA/1-125,MTLD_STRMU/2-126)),(MTLD_BACSU/1-122,MTLD_BACST/1-124)),(MTLD_CLOAB/1-123,MTLD_MYCPN/4-118)))),YEI0_YEAST/36-200),O08355_PSEFL/27-192),DALD_KLEPN/5-166),O68111_RHOCA/17-181,MTLK_RHOSH/16-179);
ATL  11.0954
DNO  16
DLN  516
DID  0.413418
DPH  ((((((YDFI_ECOLI/22-185:0.41168,YEIQ_ECOLI/25-188:0.26448):0.06357,UXUB_ECOLI/23-188:0.23875):0.13992,(YEI0_YEAST/36-200:0.27970,(UXAB_ECOLI/16-173:0.61044,((((MTLD_CLOAB/1-123:0.39924,MTLD_MYCPN/4-118:0.55599):0.14464,(MTLD_ENTFA/1-125:0.19914,MTLD_STRMU/2-126:0.23523):0.10536):0.07407,(MTLD_BACSU/1-122:0.33584,MTLD_BACST/1-124:0.27397):0.15073):0.21478,MTLD_ECOLI/1-123:0.12449):0.66028):0.17369):0.19207):0.16727,O08355_PSEFL/27-192:0.19839):0.07921,DALD_KLEPN/5-166:0.64773):0.14690,O68111_RHOCA/17-181:0.16597,MTLK_RHOSH/16-179:0.17759);
DTP  ((((((YDFI_ECOLI/22-185,YEIQ_ECOLI/25-188),UXUB_ECOLI/23-188),(YEI0_YEAST/36-200,(UXAB_ECOLI/16-173,((((MTLD_CLOAB/1-123,MTLD_MYCPN/4-118),(MTLD_ENTFA/1-125,MTLD_STRMU/2-126)),(MTLD_BACSU/1-122,MTLD_BACST/1-124)),MTLD_ECOLI/1-123)))),O08355_PSEFL/27-192),DALD_KLEPN/5-166),O68111_RHOCA/17-181,MTLK_RHOSH/16-179);
DTL  7.43112
RID  0.277924
RPH  (((((((UXUB_ECOLI/23-188:0.32240,YDFI_ECOLI/22-185:0.41304):0.11025,YEIQ_ECOLI/25-188:0.30424):0.17928,(UXAB_ECOLI/16-173:1.60023,(((MTLD_ECOLI/1-123:0.46027,(MTLD_ENTFA/1-125:0.22978,MTLD_STRMU/2-126:0.23497):0.15765):0.08363,(MTLD_BACSU/1-122:0.33346,MTLD_BACST/1-124:0.30288):0.17872):0.05067,(MTLD_CLOAB/1-123:0.53574,MTLD_MYCPN/4-118:0.94100):0.11224):1.25289):0.28937):0.13296,YEI0_YEAST/36-200:0.45321):0.18984,O08355_PSEFL/27-192:0.29740):0.15942,DALD_KLEPN/5-166:1.10825):0.23318,O68111_RHOCA/17-181:0.23986,MTLK_RHOSH/16-179:0.14271);
RTP  (((((((UXUB_ECOLI/23-188,YDFI_ECOLI/22-185),YEIQ_ECOLI/25-188),(UXAB_ECOLI/16-173,(((MTLD_ECOLI/1-123,(MTLD_ENTFA/1-125,MTLD_STRMU/2-126)),(MTLD_BACSU/1-122,MTLD_BACST/1-124)),(MTLD_CLOAB/1-123,MTLD_MYCPN/4-118)))),YEI0_YEAST/36-200),O08355_PSEFL/27-192),DALD_KLEPN/5-166),O68111_RHOCA/17-181,MTLK_RHOSH/16-179);
RTL  11.0954
LNK  DALD_KLEPN/5-166:O52720:AF045245
LNK  MTLD_BACST/1-124:Q45421:U18943
LNK  MTLD_BACSU/1-122:P42957:D38161
LNK  MTLD_CLOAB/1-123:O65992:U53868
LNK  MTLD_ECOLI/1-123:P09424:U00039
LNK  MTLD_ENTFA/1-125:P27543:AE016948
LNK  MTLD_MYCPN/4-118:P78008:AE000020
LNK  MTLD_STRMU/2-126:Q02418:AF210133
LNK  MTLK_RHOSH/16-179:P33216:AF018073
LNK  O08355_PSEFL/27-192:O08355:AF007800
LNK  O68111_RHOCA/17-181:O68111:AF010496
LNK  UXAB_ECOLI/16-173:P24214:D13327
LNK  UXUB_ECOLI/23-188:P39160:U14003
LNK  YDFI_ECOLI/22-185:P77260:U00096
LNK  YEI0_YEAST/36-200:P39941:U18795
LNK  YEIQ_ECOLI/25-188:P33029:U00007
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MTLD_BACST/1-124
ASQ  MLAVHFGAGNIGRG----FIGSLLSQ-SGYEVVFVDINDELVRL-.----LKEKQEYRVIIAD--....-ENRQELLIRNVSAVNSQTER--EKVIDYITK--AHLITTAVGP-------------HILPAIATILAEG-------------LQKRITINKTPLHIIACENM
DSQ  ATGTTAGCAGTTCATTTCGGTGCTGGAAATATCGGAAGAGGA------------TTTATCGGGAGTTTGCTTTCACAG---TCGGGCTATGAAGTAGTGTTTGTGGATATTAATGATGAATTGGTTCGTTTA---...------------TTAAAGGAAAAACAGGAGTATCGTGTGATCATTGCCGAT------............---GAAAATAGACAAGAACTGCTGATTCGCAACGTTTCCGCTGTCAATAGTCAAACGGAACGT------GAAAAGGTCATTGACTATATCACAAAG------GCTCATCTTATTACAACGGCGGTCGGGCCG---------------------------------------CATATTTTACCGGCCATCGCCACGATTCTTGCTGAGGGG---------------------------------------CTGCAAAAAAGAATCACGATCAATAAAACACCGCTTCATATTATTGCTTGTGAAAATATG
TRN  10010101100011000
NAM  MTLD_BACSU/1-122
ASQ  MIALHFGAGNIGRG----FIGALLHH-SGYDVVFADVNETMVSL-.----LNEKKEYTVELAE--....-EGRSSEIIGPVSAINSGSQT--EELYRLMNE--AALITTAVGP-------------NVLKLIAPSIAEG-------------LRRRNTAN--TLNIIACENM
DSQ  ATGATCGCCTTACATTTCGGTGCGGGAAATATCGGGAGAGGA------------TTTATCGGCGCGCTGCTTCACCAC---TCCGGCTATGATGTGGTGTTTGCGGATGTGAACGAAACGATGGTCAGCCTC---...------------CTCAATGAAAAAAAAGAATACACAGTGGAACTGGCGGAA------............---GAGGGACGTTCATCGGAGATCATTGGCCCGGTGAGCGCTATTAACAGCGGCAGTCAGACC------GAGGAGCTGTACCGGCTGATGAATGAG------GCGGCGCTCATCACAACAGCTGTCGGCCCG---------------------------------------AATGTCCTGAAGCTGATTGCCCCGTCTATCGCAGAAGGT---------------------------------------TTAAGACGAAGAAATACTGCAAAC------ACACTGAATATCATTGCCTGCGAAAATATG
TRN  10010101100011000
NAM  MTLD_STRMU/2-126
ASQ  KKAVHFGAGNIGRG----FIGQILFE-NGFAIDFVDVNDKIINA-.----LNERHSYDIEIAE--....-DGKRHITVSNVAGINNKENP--QAVIDAVAE--TELITTAIGP-------------NILPFIAQLIAKGI------------EKRRESQNQTPLDIIACENM
DSQ  AAAAAAGCAGTACATTTTGGAGCAGGCAATATTGGCCGTGGC------------TTTATTGGACAAATTTTATTTGAA---AATGGCTTTGCTATTGATTTTGTCGATGTTAACGATAAAATTATTAATGCT---...------------CTTAATGAACGTCATTCTTATGATATTGAAATTGCAGAA------............---GATGGGAAACGTCACATTACAGTTTCTAATGTTGCTGGCATTAATAACAAGGAAAATCCT------CAAGCAGTCATTGATGCTGTGGCTGAG------ACAGAGTTGATTACAACCGCTATTGGCCCT---------------------------------------AACATTTTGCCTTTTATTGCCCAATTGATTGCCAAAGGTATT------------------------------------GAAAAACGTCGTGAAAGTCAGAATCAAACGCCACTTGATATCATTGCCTGTGAAAATATG
TRN  11011101111011010
NAM  MTLD_ENTFA/1-125
ASQ  MNAVHFGAGNIGRG----FIGEILAK-NGFHITFVDVNETIIQA-.----LKERKSYTIELAD--....-ASHQQINVENVTGLNNMTEP--EKVVEAIAE--ADLVTTAIGP-------------NILPRIAELIAQGI------------DARAEANCQKPLDIIACENM
DSQ  ATGAACGCAGTACATTTTGGAGCAGGAAATATTGGACGCGGC------------TTTATCGGCGAAATTTTAGCTAAA---AACGGGTTTCATATTACGTTTGTGGATGTTAATGAAACCATCATTCAAGCG---...------------TTAAAAGAACGTAAAAGTTATACAATTGAATTGGCCGAT------............---GCCTCACATCAACAAATTAACGTTGAAAATGTGACCGGGTTAAATAACATGACAGAACCA------GAAAAAGTAGTAGAAGCAATTGCGGAA------GCCGATTTAGTCACGACGGCAATTGGTCCT---------------------------------------AATATTTTACCAAGAATTGCTGAATTAATTGCTCAAGGAATT------------------------------------GATGCACGTGCCGAAGCAAATTGTCAAAAGCCGCTGGATATTATCGCTTGTGAAAATATG
TRN  10010101100011000
NAM  MTLD_ECOLI/1-123
ASQ  MKALHFGAGNIGRG----FIGKLLAD-AGIQLTFADVNQVVLDA-.----LNARHSYQVHVVG--....-ETEQVDTVSGVNAVSSIG----DDVVDLIAQ--VDLVTTAVGP-------------VVLERIAPAIAKGQ------------VKRKEQGNESPLNIIACENM
DSQ  ATGAAAGCATTACATTTTGGCGCAGGTAATATCGGTCGTGGC------------TTTATCGGTAAACTGCTGGCAGAC---GCGGGTATCCAACTGACGTTTGCCGATGTCAATCAGGTGGTACTTGATGCC---...------------CTGAATGCCCGTCATAGCTATCAGGTACATGTGGTTGGT------............---GAAACCGAGCAGGTAGATACCGTTTCCGGCGTCAATGCTGTCAGCAGCATTGGT------------GATGATGTCGTTGATCTGATTGCTCAG------GTTGATTTAGTCACTACCGCCGTTGGCCCG---------------------------------------GTTGTGCTGGAACGTATTGCTCCGGCAATCGCCAAAGGGCAG------------------------------------GTGAAACGTAAAGAACAAGGTAATGAATCCCCGCTGAACATCATCGCCTGTGAAAACATG
TRN  11011101101011010
NAM  MTLD_CLOAB/1-123
ASQ  MKALHFGAGNIGRG----FIGYLLYK-SNYETTFVDIFDKVVDD-.----INKYKRYTVITLS--....-TSKNKEKVENVRAVNLKDS---VALEKEVLE--ADLITTSLGL-------------NNLKSTGELLRGF-------------LKKRSEINDKPLDIIACENA
DSQ  ATGAAAGCACTTCATTTTGGAGCAGGAAACATAGGAAGAGGT------------TTTATAGGTTATTTACTGTATAAG---TCTAATTACGAAACTACCTTCGTTGATATATTTGATAAAGTAGTGGATGAT---...------------ATCAATAAATATAAAAGATATACAGTAATAACTTTGAGT------............---ACATCTAAGAATAAGGAGAAAGTTGAGAATGTACGAGCAGTCAATTTGAAAGATAGT---------GTTGCTCTTGAAAAAGAAGTTTTAGAA------GCTGATTTAATAACTACATCATTAGGATTA---------------------------------------AATAATTTAAAAAGTACAGGAGAGCTTTTAAGAGGATTC---------------------------------------CTTAAAAAGAGATCAGAAATCAATGACAAGCCACTTGATATAATAGCATGTGAAAATGCA
TRN  10010101100011000
NAM  MTLD_MYCPN/4-118
ASQ  INVLHFGAGNIGRG----VILPIYQQ-NDFSIDLVELNQNTVNE-.----LQKQKQYQVHYLD--....--CDQSQLVNDFNTWNLKDEA---KIIELMER--ADVISTSIGA-------------KNLASLKTLFDKA--------------------KFHKRAIVLCFEN
DSQ  ATTAATGTATTGCACTTTGGCGCTGGTAATATAGGTAGAGGT------------GTTATATTACCGATTTACCAACAA---AATGACTTTTCCATTGATTTAGTGGAATTGAATCAAAATACAGTTAATGAG---...------------TTACAAAAGCAAAAACAATACCAAGTTCATTACCTTGAT------............------TGTGATCAAAGTCAGTTAGTTAATGACTTTAATACTTGAAACTTAAAGGATGAAGCG---------AAGATTATTGAACTAATGGAAAGA------GCTGATGTTATTTCCACTTCAATAGGTGCT---------------------------------------AAAAACTTAGCTAGTTTAAAAACTTTGTTTGACAAAGCT------------------------------------------------------------AAGTTCCATAAAAGGGCTATAGTGCTTTGCTTTGAAAAC
TRN  00010000000000000
NAM  YDFI_ECOLI/22-185
ASQ  PRIVHLGFGAFHRAHQGVYADILATE-HFSDWGYYEVNLIGGEQ-.QIADLQQQDNLYTVAEM-S....ADVWTARVVGVVKKALHVQIDGLETVLAAMCEPQIAIVSLTITEKGYFHSPATGQLMLDHPMVAADVQNPHQPKTATGVIVEALARRKAAGLPAFTVMSCDNM
DSQ  CCAAGAATTGTTCATTTAGGCTTTGGTGCATTTCACCGTGCGCATCAGGGTGTGTATGCCGATATTCTTGCTACGGAA---CATTTCAGTGACTGGGGATATTATGAGGTCAACTTAATCGGCGGCGAACAG---...CAAATTGCCGATTTACAACAGCAAGATAATCTTTATACCGTTGCGGAAATG---TCG............GCCGATGTGTGGACGGCTCGCGTCGTTGGCGTCGTTAAAAAAGCCTTGCACGTACAGATAGATGGCTTAGAAACCGTGTTGGCAGCGATGTGTGAACCGCAAATCGCGATTGTCTCTCTGACAATCACCGAAAAAGGGTATTTCCACTCTCCGGCGACCGGACAGTTAATGCTCGATCACCCGATGGTAGCTGCCGACGTGCAAAATCCCCACCAGCCGAAAACAGCAACAGGGGTGATTGTTGAGGCGCTGGCTCGCCGTAAAGCGGCAGGACTTCCCGCATTTACCGTCATGTCATGTGACAACATG
TRN  10010101100011000
NAM  UXUB_ECOLI/23-188
ASQ  SRIVHLGCGAFHRAHQALYTHHLLES-TDSDWGICEVNLMPGNDRvLIENLKKQQLLYTVAEK-G....AESTELKIIGSMKEALHPEIDGCEGILNAMARPQTAIVSLTVTEKGYCADAASGQLDLNNPLIKHDLENPTAPKSAIGYIVEALRLRREKGLKAFTVMSCDNV
DSQ  TCACGCATTGTGCATCTCGGTTGCGGGGCGTTTCACCGCGCGCACCAGGCGCTGTATACCCATCATCTGCTGGAAAGC---ACCGACAGCGACTGGGGCATCTGCGAAGTTAACCTGATGCCAGGCAACGACCGCgtgCTGATCGAAAACCTGAAAAAACAGCAACTGCTGTACACCGTAGCGGAAAAA---GGC............GCAGAGAGCACCGAGCTGAAAATTATCGGTTCGATGAAAGAAGCGCTGCATCCGGAAATCGATGGCTGCGAAGGTATTCTCAACGCGATGGCGCGTCCGCAAACGGCGATTGTCTCTCTAACGGTCACGGAAAAAGGCTACTGCGCTGATGCGGCAAGCGGTCAACTGGATCTCAATAACCCGCTGATCAAGCACGATCTGGAAAACCCGACTGCGCCGAAGTCCGCGATTGGTTACATCGTCGAAGCGTTGCGTCTGCGTCGTGAAAAAGGGTTGAAAGCGTTTACGGTGATGTCCTGCGATAACGTG
TRN  11011101101011001
NAM  YEIQ_ECOLI/25-188
ASQ  SRIVHFGFGAFHRAHQALLTDRVLNA-QGGDWGICEISLFSGDQ-.LMSQLRAQNHLYTVLEK-G....ADGNQVIIVGAVHECLNAKLDSLAAIIEKFCEPQVAIVSLTITEKGYCIDPATGALDTSNPRIIHDLQTPEEPHSAPGILVEALKRRRERGLTPFTVLSCDNI
DSQ  TCACGTATCGTTCATTTTGGCTTTGGAGCCTTTCACCGCGCTCATCAGGCGTTACTGACCGATCGTGTGCTGAATGCC---CAGGGCGGCGACTGGGGGATCTGTGAAATCAGCTTGTTCAGCGGTGATCAA---...CTGATGAGCCAGCTCCGCGCACAGAACCATTTATATACCGTGCTGGAGAAA---GGT............GCGGACGGCAATCAGGTGATAATTGTCGGTGCCGTTCACGAATGCCTTAATGCAAAACTGGATTCCTTAGCGGCAATTATTGAGAAATTTTGCGAGCCACAGGTGGCAATTGTTTCCCTGACGATTACCGAAAAAGGCTATTGTATTGACCCGGCCACCGGTGCACTCGACACCAGTAATCCGCGGATTATTCACGATCTACAAACCCCTGAAGAACCTCACTCCGCACCGGGTATTCTCGTCGAAGCACTGAAACGCCGCCGTGAGCGCGGCCTTACACCGTTTACCGTGCTCTCCTGCGACAATATT
TRN  10010101100011000
NAM  YEI0_YEAST/36-200
ASQ  QGIVHLGVGAFHRSHLAVFMHRLMQEHHLKDWSICGVGLMKADAL.MRDAMKAQDCLYTLVER-G....IKDTNAYIVGSITAYMYAPDD-PRAVIEKMANPDTHIVSLTVTENGYYHSEATNSLMTDAPEIINDLNHPEKPDTLYGYLYEALLLRYKRGLTPFTIMSCDNM
DSQ  CAAGGTATTGTTCATCTGGGAGTCGGTGCATTCCACCGTTCCCATTTAGCTGTTTTCATGCACCGTCTGATGCAGGAGCACCACTTAAAGGACTGGTCCATATGTGGTGTTGGTTTAATGAAGGCAGATGCACTT...ATGCGCGATGCCATGAAGGCCCAAGATTGCCTATACACCCTTGTGGAGCGT---GGT............ATCAAGGACACTAACGCTTATATCGTCGGTTCCATTACTGCTTACATGTACGCTCCCGATGAT---CCAAGAGCTGTTATTGAAAAGATGGCCAATCCAGACACACACATTGTTTCTTTGACGGTCACAGAAAACGGTTACTACCACAGTGAAGCAACAAACTCCTTAATGACAGATGCTCCCGAGATTATCAATGATTTGAACCACCCAGAAAAGCCAGATACTCTGTATGGGTACCTATATGAAGCCCTGTTGTTGCGTTACAAGAGAGGTCTTACCCCATTCACTATTATGTCATGTGACAACATG
TRN  10010101100011000
NAM  MTLK_RHOSH/16-179
ASQ  PGIVHIGVGNFHRAHQAVYLDDLFALGEGHDWAILGAGVRPTDAR.MREALAAQDNLSTVIEL-D....PAGHRARQVGAMVGFLPVEAD-NAALIEAMSDPRIRIVSLTVTEGGYYVDAS-GAFDPTHPDIVADAAHPARPATAFGAILAALRARRDAGVTPFTVMSCDNL
DSQ  CCCGGCATCGTCCATATCGGCGTCGGCAACTTCCACCGGGCGCATCAGGCGGTCTATCTCGACGATCTCTTCGCGCTGGGCGAGGGCCACGACTGGGCCATCCTCGGCGCGGGCGTCCGCCCGACCGATGCGCGG...ATGCGCGAGGCTCTGGCCGCGCAGGACAATCTCTCGACGGTGATCGAGCTC---GAT............CCGGCGGGCCACCGGGCCCGGCAGGTGGGGGCGATGGTGGGCTTCCTGCCGGTCGAGGCCGAC---AATGCGGCCCTGATCGAGGCCATGTCGGATCCGCGCATCCGCATCGTCTCGCTGACCGTGACCGAGGGCGGCTATTATGTCGATGCCTCG---GGCGCCTTCGATCCGACGCATCCCGATATCGTGGCCGATGCGGCCCATCCTGCGCGGCCCGCGACCGCCTTCGGCGCGATCCTCGCCGCCCTCCGCGCCCGCCGCGACGCGGGGGTTACACCCTTCACCGTGATGTCCTGCGACAACCTC
TRN  11011111101111111
NAM  O68111_RHOCA/17-181
ASQ  PGIVHIGLGNFHRAHQAVYLDDLFGLGEGHDWALIGAGVRAPDAA.MREVLLAQDGLSSVIEL-A....PGAHSARVIGAMIDFVAVQPG-NAALIATMARPEIRIVSLTVTEGGYYIDPNTGTFSPDHPDIQADAARPDAPDTAFGAIIAALKMRRAAGVAPFTVMCCDNV
DSQ  CCCGGCATCGTCCATATCGGGCTTGGCAACTTTCACCGCGCGCATCAGGCGGTTTATCTGGATGACCTTTTCGGCTTGGGCGAGGGGCACGACTGGGCGCTGATCGGCGCCGGTGTCCGCGCCCCCGATGCCGCG...ATGCGTGAGGTGCTTCTGGCGCAGGACGGCCTGTCCTCGGTGATCGAACTC---GCC............CCCGGCGCCCATTCCGCCCGCGTGATCGGCGCGATGATCGACTTTGTCGCGGTGCAACCGGGC---AATGCCGCGCTGATCGCCACGATGGCGCGGCCGGAGATCCGCATCGTCAGCCTGACCGTGACCGAGGGCGGCTATTACATCGACCCGAACACCGGCACCTTCAGCCCCGATCACCCGGACATTCAGGCCGATGCCGCCCGTCCCGATGCGCCTGACACCGCCTTTGGCGCGATCATCGCCGCGCTGAAGATGCGCCGCGCCGCGGGCGTCGCCCCCTTCACCGTGATGTGCTGCGACAACGTC
TRN  11011111101111111
NAM  O08355_PSEFL/27-192
ASQ  QGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWSICGVGLRSEDRK.ARDDLAGQDYLFTLYELGD....TDDTEVRVIGSISDMLLAEDS-AQALIDKLASPEIRIVSLTITEGGYCIDDSNGEFMAHLPQIQHDLAHPSSPKTVFGFICAALTQRRAAGIPAFTVMSCDNL
DSQ  CAGGGCATCGCCCATATCGGCGTCGGCGGCTTCCATCGCGCGCACCAGGCGTATTACACCGATGCGCTGATGAATACCGGCGAGGGCCTGGACTGGAGCATCTGCGGCGTTGGCCTGCGCAGCGAGGACCGCAAG...GCCCGCGATGACCTGGCCGGCCAGGACTACCTGTTCACCCTGTACGAACTGGGCGAC............ACCGACGACACCGAAGTGCGCGTGATCGGCTCGATCAGCGACATGCTGCTGGCCGAAGACAGC---GCCCAGGCATTGATCGATAAACTGGCCAGCCCCGAGATTCGCATCGTCTCGCTGACCATCACCGAAGGCGGCTACTGCATCGACGACAGCAACGGCGAATTCATGGCCCACTTGCCGCAGATCCAGCACGACCTGGCTCATCCGTCGTCGCCAAAAACCGTGTTCGGCTTTATCTGCGCGGCATTGACCCAGCGCCGCGCGGCCGGCATCCCGGCGTTTACCGTGATGTCCTGCGATAACCTG
TRN  11011101101011011
NAM  DALD_KLEPN/5-166
ASQ  FTWLHIGLGSFHRAHQAWYLHRLIAS-GDNRWRIAAGNIRNDAEQ.VVQALAAQGGRYVLETVSP....EGEREYEEITSIQKLLPWQAG-LQPLINEGANPQTKVIAFTVTEGGYYLN-TRHRLETSNPDLQADLQGECK--TIYGTLARILEKRMADNAGPLTLLNCDNV
DSQ  TTCACATGGCTTCATATCGGTCTGGGTTCTTTTCATCGCGCGCATCAGGCGTGGTATCTGCATCGTCTGATTGCTTCC---GGGGATAATCGCTGGCGCATCGCGGCGGGGAATATTCGCAACGACGCCGAGCAG...GTGGTCCAGGCGCTGGCGGCGCAGGGAGGACGTTACGTCCTCGAGACCGTCAGCCCG............GAAGGGGAGCGCGAATATGAAGAGATCACCTCAATCCAGAAACTGCTACCGTGGCAGGCCGGG---CTACAGCCGCTGATTAACGAAGGGGCAAACCCGCAGACCAAAGTTATCGCCTTTACCGTGACGGAAGGGGGGTACTACCTGAAC---ACTCGCCATCGGCTGGAAACCAGCAACCCCGATCTGCAGGCCGACCTGCAAGGCGAGTGCAAA------ACCATTTACGGCACCCTCGCGCGGATCCTGGAAAAGCGCATGGCCGACAACGCCGGGCCGCTGACCCTGCTCAACTGCGATAACGTG
TRN  11011101101011001
NAM  UXAB_ECOLI/16-173
ASQ  ERIIQFGEGNFLRAFVD-WQIDLLNEHTDLNSGVVVVRPIETSFP.--PSLSTQDGLYTTIIRGLnekgEAVSDARLIRSVNREISVYSEY-DEFLKLAHNPEMRFVFSNTTEAG--ISYHAGDKFDDAPAVSYPAKLTR-------LLFERFSHFNGALDKGWIIIPCELI
DSQ  GAACGTATCATTCAGTTTGGTGAAGGTAACTTCCTGCGCGCCTTTGTTGAC---TGGCAAATCGATCTCCTGAATGAGCACACCGATCTGAATTCTGGCGTGGTCGTTGTTCGTCCGATTGAAACTTCATTCCCG...------CCGTCACTGAGCACGCAGGATGGTCTGTACACCACCATTATCCGTGGCCTGaatgagaaggggGAAGCGGTCAGCGACGCGCGTCTGATTCGCTCGGTTAATCGTGAAATCAGCGTCTACAGTGAATAC---GATGAATTCCTGAAACTGGCGCACAACCCGGAAATGCGCTTTGTTTTCTCTAACACCACCGAAGCGGGT------ATCAGCTACCATGCGGGCGATAAATTCGATGACGCGCCAGCGGTAAGCTATCCGGCAAAACTGACCCGT---------------------CTGCTGTTCGAACGCTTTAGCCATTTCAACGGTGCGCTGGATAAAGGTTGGATCATCATTCCGTGTGAGTTGATT
TRN  11011101101011001
//