EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01227 - GTP_cyclohydroI)
FAM  PF01227
PID  GTP_cyclohydroI
DES  GTP cyclohydrolase I
IPR  IPR001474
ANO  16
ALN  107
AID  0.326373
APH  ((((((((GCH1_SYNP7/85-189:0.08357,(GCH1_CAEEL/100-204:0.15639,GCH1_YEAST/119-223:0.11609):0.13506):0.11335,(GCH1_ECOLI/97-201:0.13943,GCH1_HAEIN/96-200:0.16807):0.51360):0.02957,(GCH1_BACSU/65-170:0.18510,GCH1_STRPN/62-166:0.38812):0.13824):1.20249,Q9YBX9_AERPE/44-139:0.86789):0.28587,Q9WZP8_THEMA/32-126:0.29734):0.42679,((O67073_AQUAE/30-129:0.24474,Q9PLV4_CAMJE/27-126:0.29672):0.13801,Q55978_SYNY3/37-136:0.47254):0.16051):0.42389,(O31678_BACSU/43-142:0.15445,Q9ZJJ9_HELPJ/37-134:0.39314):0.17610):0.41171,Q983K4_RHILO/38-137:0.16161,Q9A515_CAUCR/36-135:0.15197);
ATP  ((((((((GCH1_SYNP7/85-189,(GCH1_CAEEL/100-204,GCH1_YEAST/119-223)),(GCH1_ECOLI/97-201,GCH1_HAEIN/96-200)),(GCH1_BACSU/65-170,GCH1_STRPN/62-166)),Q9YBX9_AERPE/44-139),Q9WZP8_THEMA/32-126),((O67073_AQUAE/30-129,Q9PLV4_CAMJE/27-126),Q55978_SYNY3/37-136)),(O31678_BACSU/43-142,Q9ZJJ9_HELPJ/37-134)),Q983K4_RHILO/38-137,Q9A515_CAUCR/36-135);
ATL  8.42105
DNO  15
DLN  321
DID  0.416316
DPH  ((((((((Q9PLV4_CAMJE/27-126:0.28181,O67073_AQUAE/30-129:0.28353):0.11904,Q55978_SYNY3/37-136:0.32886):0.16093,((O31678_BACSU/43-142:0.21079,Q9ZJJ9_HELPJ/37-134:0.37025):0.08559,(Q983K4_RHILO/38-137:0.18470,Q9A515_CAUCR/36-135:0.17038):0.34127):0.20197):0.36260,Q9WZP8_THEMA/32-126:0.23952):0.18749,Q9YBX9_AERPE/44-139:0.55050):0.71403,(GCH1_BACSU/65-170:0.28210,GCH1_STRPN/62-166:0.29361):0.07219):0.07045,(GCH1_CAEEL/100-204:0.19196,GCH1_YEAST/119-223:0.20500):0.21159):0.31882,GCH1_ECOLI/97-201:0.29552,GCH1_HAEIN/96-200:0.13646);
DTP  ((((((((Q9PLV4_CAMJE/27-126,O67073_AQUAE/30-129),Q55978_SYNY3/37-136),((O31678_BACSU/43-142,Q9ZJJ9_HELPJ/37-134),(Q983K4_RHILO/38-137,Q9A515_CAUCR/36-135))),Q9WZP8_THEMA/32-126),Q9YBX9_AERPE/44-139),(GCH1_BACSU/65-170,GCH1_STRPN/62-166)),(GCH1_CAEEL/100-204,GCH1_YEAST/119-223)),GCH1_ECOLI/97-201,GCH1_HAEIN/96-200);
DTL  6.86764
RID  0.320044
RPH  (((Q983K4_RHILO/38-137:0.16060,Q9A515_CAUCR/36-135:0.15165):0.40961,(((O67073_AQUAE/30-129:0.24350,Q9PLV4_CAMJE/27-126:0.29471):0.13412,Q55978_SYNY3/37-136:0.47274):0.15326,(Q9WZP8_THEMA/32-126:0.31349,(Q9YBX9_AERPE/44-139:0.87714,(((GCH1_BACSU/65-170:0.19744,GCH1_STRPN/62-166:0.37601):0.16455,(GCH1_ECOLI/97-201:0.12873,GCH1_HAEIN/96-200:0.17630):0.49752):0.05907,(GCH1_CAEEL/100-204:0.14679,GCH1_YEAST/119-223:0.11442):0.12028):1.05294):0.29563):0.40082):0.42722):0.17620,Q9ZJJ9_HELPJ/37-134:0.39188,O31678_BACSU/43-142:0.15311);
RTP  (((Q983K4_RHILO/38-137,Q9A515_CAUCR/36-135),(((O67073_AQUAE/30-129,Q9PLV4_CAMJE/27-126),Q55978_SYNY3/37-136),(Q9WZP8_THEMA/32-126,(Q9YBX9_AERPE/44-139,(((GCH1_BACSU/65-170,GCH1_STRPN/62-166),(GCH1_ECOLI/97-201,GCH1_HAEIN/96-200)),(GCH1_CAEEL/100-204,GCH1_YEAST/119-223)))))),Q9ZJJ9_HELPJ/37-134,O31678_BACSU/43-142);
RTL  8.08973
LNK  GCH1_BACSU/65-170:P19465:M37320
LNK  GCH1_CAEEL/100-204:Q19980:Z72509
LNK  GCH1_ECOLI/97-201:P27511:X63910
LNK  GCH1_HAEIN/96-200:P43866:U32823
LNK  GCH1_STRPN/62-166:P51595:AE007342
LNK  GCH1_SYNP7/85-189:Q54769:
LNK  GCH1_YEAST/119-223:P51601:X94314
LNK  O31678_BACSU/43-142:O31678:Z99111
LNK  O67073_AQUAE/30-129:O67073:AE000714
LNK  Q55978_SYNY3/37-136:Q55978:BA000022
LNK  Q983K4_RHILO/38-137:Q983K4:BA000012
LNK  Q9A515_CAUCR/36-135:Q9A515:AE005933
LNK  Q9PLV4_CAMJE/27-126:Q9PLV4:AL139079
LNK  Q9WZP8_THEMA/32-126:Q9WZP8:AE001747
LNK  Q9YBX9_AERPE/44-139:Q9YBX9:BA000002
LNK  Q9ZJJ9_HELPJ/37-134:Q9ZJJ9:AE001554
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GCH1_HAEIN/96-200
ASQ  EMVQVNDITLTSTCEHHFVTIDGKVCVAYYP.KD.WVIGLSKINRIVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVTSAYGG
DSQ  GAAATGGTACAAGTGAATGACATTACGCTAACAAGCACTTGTGAACATCATTTTGTGACGATTGATGGTAAAGTTTGTGTGGCATACTATCCA...AAAGAT...TGGGTGATTGGTCTTTCTAAAATTAATCGAATTGTCTCGTTTTTTGCGCAACGTCCACAGGTTCAAGAACGCTTAACTGAGCAACTTTTGACAGCATTTCAAACCATTCTTGAGACCGATGATGTGGCGGTATATGTGAAAGCGACCCATTTCTGTGTGAAAGCGCGTGGTATTAGAGATACGAATAGTTATACTGTCACATCTGCTTATGGTGGC
TRN  10010101110011010
NAM  GCH1_ECOLI/97-201
ASQ  EMVTVRDITLTSTCEHHFVTIDGKATVAYIP.KD.SVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGG
DSQ  GAAATGGTCACCGTGCGCGATATCACTCTGACCAGCACCTGTGAACACCATTTTGTTACCATCGATGGCAAAGCGACGGTGGCCTATATCCCG...AAAGAT...TCGGTGATCGGTCTGTCAAAAATTAACCGCATTGTGCAGTTCTTTGCCCAGCGTCCGCAGGTGCAGGAACGTCTGACGCAGCAAATTCTTATTGCGCTACAAACGCTGCTGGGCACCAATAACGTGGCTGTCTCGATCGACGCGGTGCATTACTGCGTGAAGGCGCGTGGCATCCGCGATGCAACCAGTGCCACGACAACGACCTCTCTTGGTGGA
TRN  11011101101011001
NAM  GCH1_STRPN/62-166
ASQ  NMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP.DG.RVAGLSKLARTVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARG
DSQ  AATATGGTGGTAGAAAAGGATATCTTTTTCCATACCATGTGTGAACACCACTTCTTGCCATTTTATGGTAGAGCGCACATTGCCTACATTCCA...GATGGT...CGTGTGGCAGGCTTGTCTAAGCTAGCCCGTACGGTTGAAGTTTATTCGAAAAAACCACAAATTCAAGAACGTTTGAATATCGAAGTGGCCGATGCCTTGATGGACTATCTAGGTGCTAAAGGAGCCTTTGTTGTCATTGAGGCGGAACATATGTGTATGAGTATGCGTGGTGTTAGAAAACCAGGCACTGCAACCTTGACGACAGTAGCTCGTGGT
TRN  10010101110011011
NAM  GCH1_SYNP7/85-189
ASQ  EMVLVRDITAFSLCEHHMLPFMGKVHVAYIP.NQ.KVVGLSKLARIVEMYSRRLQVQERLTRQIAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVG
NAM  GCH1_YEAST/119-223
ASQ  EMVIVRDIEIYSLCEHHLVPFFGKVHIGYIP.NK.KVIGLSKLARLAEMYARRLQVQERLTKQIAMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVTSCMLG
DSQ  GAAATGGTTATTGTTCGTGATATTGAAATTTACTCGTTATGTGAACATCATTTGGTGCCATTTTTCGGCAAGGTTCATATCGGGTATATACCA...AATAAA...AAAGTCATCGGGTTAAGTAAGTTGGCCAGATTGGCAGAAATGTATGCGAGAAGGCTCCAAGTTCAAGAAAGACTTACAAAGCAAATTGCAATGGCCCTAAGTGATATTCTAAAACCATTAGGTGTAGCCGTTGTTATGGAAGCTTCTCATATGTGCATGGTTTCAAGAGGCATTCAAAAAACGGGATCTTCTACGGTAACTTCTTGTATGCTTGGA
TRN  10010101110011000
NAM  GCH1_CAEEL/100-204
ASQ  EMVIVKDIEMFSLCEHHLVPFMGKVHIGYIP.NK.KVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVAVVIEASHMCMVMRGVQKINASTTTSCMLG
DSQ  GAGATGGTTATTGTGAAAGATATTGAAATGTTCTCCCTTTGTGAGCATCATTTAGTTCCATTTATGGGAAAAGTTCATATTGGATACATTCCA...AACAAG...AAGGTTCTTGGTCTGTCCAAGTTGGCAAGAATAGTCGAGATGTTCAGCAGAAGACTTCAAGTCCAAGAACGTCTTACAAAGCAAATTGCCACCGCAATGGTTCAAGCTGTACAACCATCCGGAGTTGCAGTTGTTATTGAAGCTAGTCACATGTGTATGGTAATGAGAGGAGTTCAAAAGATCAATGCTTCCACCACAACATCCTGCATGTTGGGA
TRN  10010101100011010
NAM  GCH1_BACSU/65-170
ASQ  ELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPrGG.KVTGLSKLARAVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRG
DSQ  GAGCTTGTTCTTGTAAAAGATATAGCGTTTCATTCTATGTGTGAGCATCACCTTGTTCCCTTTTATGGAAAAGCACATGTTGCATATATCCCGcgaGGCGGA...AAGGTCACAGGACTCAGCAAACTGGCACGTGCCGTTGAAGCCGTTGCAAAGCGCCCGCAGCTTCAGGAACGCATCACTTCTACAATTGCAGAAAGCATCGTAGAAACGCTTGATCCGCATGGCGTAATGGTAGTGGTTGAAGCGGAACACATGTGCATGACGATGCGCGGTGTAAGAAAACCGGGTGCGAAAACTGTGACTTCAGCAGTCAGAGGC
TRN  10010101100011001
NAM  Q9YBX9_AERPE/44-139
ASQ  LHIVLET-AVDAVCPFTGAPDSYDVEIEYVS.RD.ACLEALSLASWLESFRGVKISQEQLAHEIALTLKELLKPEYVCVKLTGSH------G--RVGMVVERCEDTS
DSQ  CTCCACATAGTGCTTGAGACC---GCTGTTGATGCTGTGTGCCCCTTCACGGGGGCTCCCGACAGCTATGACGTAGAGATAGAGTACGTTAGC...AGGGAC...GCCTGCCTGGAAGCCCTGAGTCTGGCCAGCTGGCTCGAGAGTTTCAGGGGGGTTAAGATAAGCCAGGAGCAGCTGGCCCATGAGATAGCGTTAACCCTTAAGGAGCTGCTGAAGCCTGAATACGTCTGCGTGAAGCTGACTGGGAGTCAT------------------GGG------AGGGTTGGTATGGTGGTTGAAAGATGTGAGGACACGAGC
TRN  10010101100011010
NAM  Q9WZP8_THEMA/32-126
ASQ  EYIKIETDEFSAVCPFSGLPDIGRVIIEYYP.DGgKIVELKSLKYYFVSFRNVGIYQEEATKRIYEDLKNLLKTDRIRVTVIYN-----IRGGIK------TTTQMG
DSQ  GAGTACATAAAGATAGAGACCGACGAGTTCTCCGCAGTCTGTCCCTTCTCCGGTCTTCCAGACATCGGGAGAGTGATCATAGAGTATTACCCG...GACGGTggaAAGATCGTCGAACTCAAATCTTTGAAGTACTACTTCGTCAGCTTCAGAAACGTTGGTATATACCAGGAAGAAGCAACGAAGAGAATCTACGAAGATTTGAAGAATCTTCTCAAAACCGACCGAATCAGGGTCACGGTGATCTACAAC---------------ATAAGGGGTGGCATAAAG------------------ACAACCACTCAGATGGGT
TRN  10010101110011011
NAM  Q55978_SYNY3/37-136
ASQ  YDVHITLPEFTCKCPFSGYPDFATLYLTYCP.DQ.KVVELKSIKLYINSYRDRHIPHEEVTNQILDDFVAVANPLYARLKADFNP-----RGNVHTVIEVEYHQEKA
DSQ  TACGATGTCCATATCACCCTGCCGGAATTCACCTGTAAATGTCCTTTTTCCGGCTACCCGGATTTTGCCACCCTTTATCTGACCTATTGCCCT...GACCAG...AAGGTGGTGGAGCTAAAGTCTATCAAGCTTTACATCAATAGTTACCGCGATCGCCATATTCCCCATGAGGAAGTAACCAATCAGATTTTGGATGACTTTGTGGCGGTGGCCAATCCTTTGTACGCTAGACTAAAAGCTGATTTTAATCCC---------------CGGGGGAATGTTCATACGGTGATTGAAGTGGAATATCATCAGGAAAAAGCT
TRN  10010101100011011
NAM  Q9PLV4_CAMJE/27-126
ASQ  YIIKITLPEFMCCCPRSGYPDFATIYLEYMP.DK.FVVELKAIKLYINTFMYRNVSHEASINEIYNTLKDKLKPKWIKVVGDFNP-----RGNVHTVIECRSDMVVP
DSQ  TATATCATTAAAATCACCTTGCCTGAATTTATGTGTTGTTGTCCGCGTTCAGGTTATCCTGATTTTGCAACGATTTATCTTGAGTATATGCCT...GATAAA...TTTGTGGTTGAGCTTAAAGCGATAAAACTTTATATCAATACTTTTATGTATAGAAATGTTTCACATGAAGCAAGTATCAATGAAATTTATAATACTCTAAAAGACAAACTCAAGCCAAAATGGATTAAAGTAGTAGGGGATTTTAATCCG---------------CGCGGAAATGTACACACAGTCATAGAATGTCGTAGCGATATGGTAGTACCA
TRN  10010101110011001
NAM  O67073_AQUAE/30-129
ASQ  YMIEITFPEFTCLCPRSGYPDFATIKIRYIP.DK.YIVELKSLKLWLNKFRNRYISHEAATNEIYQALYDLLKPRFLEVVGDFHP-----RGNVHTVVRVRSDENYG
DSQ  TACATGATAGAGATAACATTTCCTGAATTTACGTGCCTGTGTCCGCGTTCAGGTTATCCAGACTTTGCAACGATAAAAATCCGCTACATTCCC...GACAAG...TACATAGTTGAGTTAAAGTCCTTAAAGCTCTGGCTCAATAAGTTCAGGAACAGGTACATATCCCACGAGGCGGCTACAAACGAGATATACCAAGCCCTTTACGACCTTCTTAAACCCAGATTCTTGGAAGTTGTGGGAGACTTTCATCCG---------------AGGGGTAATGTGCATACCGTTGTAAGGGTAAGGAGTGATGAGAATTACGGA
TRN  10010101100011000
NAM  Q9A515_CAUCR/36-135
ASQ  YLARFVAPEFTSLCPVTGQPDFAHLVIDYAP.GD.WLIESKSLKLYLTSFRNHGSFHEDCTVKVARKIVEIAQPRWLRIGGYWYP-----RGGIPIDVFWQTGPAPE
DSQ  TATCTGGCCCGCTTCGTCGCGCCGGAGTTCACCTCGCTGTGCCCCGTCACCGGCCAGCCTGATTTCGCGCACCTTGTCATCGACTATGCGCCG...GGCGAC...TGGCTGATCGAGAGCAAGTCGCTGAAGCTCTATCTGACCAGCTTCCGCAATCACGGCTCATTCCACGAGGACTGCACGGTGAAGGTGGCGCGCAAGATCGTCGAGATCGCGCAGCCGCGCTGGCTGCGGATCGGCGGCTACTGGTATCCG---------------CGCGGCGGCATTCCGATCGACGTGTTCTGGCAGACCGGACCCGCGCCGGAA
TRN  11011111101111101
NAM  Q983K4_RHILO/38-137
ASQ  AIVRFTCPEFTSLCPVTGQPDFAHIVIDYAP.DA.ALVESKSLKLFMTSFRNHGAFHEDCTVMIGRRIVAATKPLWLRIGGYWYP-----RGGIPIDVFWQTGAPPE
DSQ  GCGATCGTGCGCTTCACCTGCCCGGAATTCACCTCGCTTTGCCCGGTGACCGGCCAGCCGGATTTCGCCCATATCGTCATCGACTACGCACCC...GATGCG...GCTTTGGTGGAATCGAAGTCGCTGAAGCTGTTCATGACCTCGTTTCGCAACCACGGCGCCTTCCATGAGGATTGTACCGTCATGATCGGCCGCCGCATCGTTGCAGCAACCAAGCCGCTATGGTTGCGCATAGGCGGCTATTGGTATCCG---------------CGCGGCGGCATTCCGATCGACGTTTTCTGGCAGACCGGCGCTCCACCTGAA
TRN  10010111100111011
NAM  Q9ZJJ9_HELPJ/37-134
ASQ  PLITLECKEFTSLCPITSQPDFGVIFIRYIP.KD.KMVESKSLKLYLFSYRNHGSFHESCINTILLDLVQLLEPKYLEVYGDF-----VSRGGIAIKPFVNYAIK--
DSQ  CCCCTAATCACTTTAGAATGCAAGGAATTTACAAGCCTTTGTCCGATCACTTCCCAGCCGGATTTTGGCGTGATTTTTATCCGCTACATCCCT...AAAGAT...AAAATGGTAGAAAGCAAGTCTCTAAAACTCTATTTGTTCAGTTACAGAAACCATGGGAGTTTTCATGAGAGCTGTATCAATACGATTTTATTAGATTTAGTCCAATTGCTAGAGCCAAAGTATTTGGAAGTGTATGGGGATTTT---------------GTTTCTAGAGGGGGGATTGCGATCAAGCCCTTTGTGAATTATGCGATCAAA------
TRN  10010101110011010
NAM  O31678_BACSU/43-142
ASQ  YFVKFNCPEFTSLCPKTGQPDFATIYISYIP.DE.KMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPRYIEVWGKFTP-----RGGISIDPYTNYGKPGT
DSQ  TACTTTGTAAAATTCAATTGCCCGGAATTCACATCTTTATGTCCTAAAACAGGCCAGCCTGACTTTGCGACAATCTACATCAGCTACATTCCT...GATGAA...AAAATGGTTGAAAGCAAATCATTAAAGCTGTATCTATTCAGCTTCAGAAACCATGGTGACTTCCACGAGGACTGCATGAATATCATCATGAACGACTTGATTGAATTAATGGACCCGCGCTACATTGAAGTATGGGGCAAATTCACGCCA---------------AGAGGCGGAATTTCCATTGATCCGTACACAAACTACGGAAAGCCTGGCACG
TRN  10010101100011000
//