EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01215 - COX5B)
FAM  PF01215
PID  COX5B
DES  Cytochrome c oxidase subunit Vb
IPR  IPR002124
ANO  4
ALN  99
AID  0.353952
APH  ((COX5_DICDI/17-113:1.65463,COX5B_BOVIN/1-97:0.83400):0.16937,COX4_YEAST/51-149:0.38801,COX4_SCHPO/60-158:0.23142);
ATP  ((COX5_DICDI/17-113,COX5B_BOVIN/1-97),COX4_YEAST/51-149,COX4_SCHPO/60-158);
ATL  3.27743
DNO  3
DLN  297
DID  0.485045
DPH  (COX4_YEAST/51-149:0.33214,COX4_SCHPO/60-158:0.25558,COX5_DICDI/17-113:0.81378);
DTP  (COX4_YEAST/51-149,COX4_SCHPO/60-158,COX5_DICDI/17-113);
DTL  1.4015
RID  0.370856
RPH  (COX4_YEAST/51-149:0.41896,COX4_SCHPO/60-158:0.20042,COX5_DICDI/17-113:1.80428);
RTP  (COX4_YEAST/51-149,COX4_SCHPO/60-158,COX5_DICDI/17-113);
RTL  2.42366
LNK  COX4_SCHPO/60-158:P79010:AB000399
LNK  COX4_YEAST/51-149:P04037:X01418
LNK  COX5B_BOVIN/1-97:P00428:
LNK  COX5_DICDI/17-113:P29505:X55671
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  COX5B_BOVIN/1-97
ASQ  ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATS-GTKEDPNLVPSITNKRIVGCICEEDNS-TVIWFWLHKGEAQRCPSCGTHYKLVPHQLA
NAM  COX4_YEAST/51-149
ASQ  AKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVP
DSQ  GCTAAAGAGGGTACCGTTCCAACAGACCTAGATCAAGAAACTGGTTTAGCTAGGTTAGAATTATTGGGTAAATTAGAGGGTATCGATGTTTTCGACACCAAACCATTAGATTCGTCCAGGAAGGGTACCATGAAAGATCCGATCATCATTGAATCTTATGATGATTATCGTTATGTCGGTTGTACGGGTTCTCCCGCTGGTTCACATACTATTATGTGGTTAAAACCAACTGTTAACGAAGTCGCCAGATGCTGGGAATGTGGTTCTGTTTACAAACTAAACCCTGTTGGTGTTCCA
TRN  10010101110011000
NAM  COX4_SCHPO/60-158
ASQ  GRDGEVPTDLEQATGLERYELLSELSGRDAFDMKPLDASRKGTLTDPIMVTSLDPYRHIGCTGSPSGSHNLIWMTVYKDKLRRCPECGSVYKLKFMGDP
DSQ  GGTCGTGACGGCGAGGTTCCAACTGATTTGGAGCAAGCCACTGGTTTGGAACGATATGAACTTTTATCAGAGCTTTCAGGGAGAGATGCATTTGATATGAAACCGTTGGATGCTTCTCGTAAAGGCACATTGACGGATCCTATAATGGTCACTTCTCTTGATCCTTACCGTCATATTGGCTGTACTGGTAGTCCTTCTGGTTCACATAATTTAATTTGGATGACTGTCTACAAAGACAAACTCCGCCGTTGTCCTGAATGCGGATCTGTATACAAATTAAAATTCATGGGAGATCCC
TRN  10010101110011000
NAM  COX5_DICDI/17-113
ASQ  MEFFHKPASNSLLDASELNFVRRNIKRED-FGHEVLTGAF-GTLKSPVIVESIFHSRIVACEGGDGEEHDILFHTVAEKKPTICLDCGQVFKLKHISSE
DSQ  ATGGAATTTTTCCATAAACCAGCATCAAACTCTTTACTTGATGCATCAGAACTCAATTTTGTTAGAAGAAATATTAAAAGAGAGGAT---TTCGGTCATGAAGTCTTAACAGGTGCTTTT---GGTACATTAAAATCACCAGTTATTGTTGAATCAATTTTCCATAGCAGAATTGTTGCCTGTGAAGGTGGTGATGGTGAAGAACATGATATTCTCTTCCATACTGTTGCTGAAAAGAAACCAACCATTTGTTTAGATTGTGGTCAAGTTTTCAAACTTAAACACATTAGCTCTGAA
TRN  10010101110011000
//