EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01214 - CK_II_beta)
FAM  PF01214
PID  CK_II_beta
DES  Casein kinase II regulatory subunit
IPR  IPR000704
ANO  7
ALN  208
AID  0.517465
APH  (((CSK2B_SCHPO/16-187:0.20722,(CSK2C_YEAST/38-213:0.41860,STELL_DROME/11-172:0.75179):0.09166):0.12662,(CSK2B_ARATH/101-275:0.30824,CSK2B_YEAST/26-233:0.61073):0.05311):0.24103,CSK2B_RAT/9-183:0.02888,CSK2B_CAEEL/9-182:0.19023);
ATP  (((CSK2B_SCHPO/16-187,(CSK2C_YEAST/38-213,STELL_DROME/11-172)),(CSK2B_ARATH/101-275,CSK2B_YEAST/26-233)),CSK2B_RAT/9-183,CSK2B_CAEEL/9-182);
ATL  3.05542
DNO  7
DLN  624
DID  0.532477
DPH  (((STELL_DROME/11-172:0.51732,CSK2B_YEAST/26-233:0.36267):0.12546,(CSK2B_ARATH/101-275:0.29997,(CSK2B_SCHPO/16-187:0.24985,CSK2C_YEAST/38-213:0.35193):0.13504):0.09401):0.13440,CSK2B_RAT/9-183:0.19182,CSK2B_CAEEL/9-182:0.24724);
DTP  (((STELL_DROME/11-172,CSK2B_YEAST/26-233),(CSK2B_ARATH/101-275,(CSK2B_SCHPO/16-187,CSK2C_YEAST/38-213))),CSK2B_RAT/9-183,CSK2B_CAEEL/9-182);
DTL  2.70971
RID  0.517465
RPH  (((CSK2B_SCHPO/16-187:0.20722,(CSK2C_YEAST/38-213:0.41860,STELL_DROME/11-172:0.75179):0.09166):0.12662,(CSK2B_ARATH/101-275:0.30824,CSK2B_YEAST/26-233:0.61073):0.05311):0.24103,CSK2B_RAT/9-183:0.02888,CSK2B_CAEEL/9-182:0.19023);
RTP  (((CSK2B_SCHPO/16-187,(CSK2C_YEAST/38-213,STELL_DROME/11-172)),(CSK2B_ARATH/101-275,CSK2B_YEAST/26-233)),CSK2B_RAT/9-183,CSK2B_CAEEL/9-182);
RTL  3.05542
LNK  CSK2B_ARATH/101-275:P40228:L22563
LNK  CSK2B_CAEEL/9-182:P28548:M73827
LNK  CSK2B_RAT/9-183:P67874:L15619
LNK  CSK2B_SCHPO/16-187:P40232:AL133361
LNK  CSK2B_YEAST/26-233:P43639:U21283
LNK  CSK2C_YEAST/38-213:P38930:U08849
LNK  STELL_DROME/11-172:P15021:X15899
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  STELL_DROME/11-172
ASQ  WIDWFLGIKGNQFLCRVPTDYVQDTFNQMGL---E-YFSEILDVILKPVIDS-------------------------------------SSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCDRQNTLPVGLSAVWGKSTVKIHCPRCKSNFHPKS--DTQLDGAMFGPSFPDIFFSLLPNLTS---PLDDPRT
DSQ  TGGATCGATTGGTTCCTCGGGATCAAGGGCAACCAGTTCCTCTGCCGCGTGCCCACCGACTACGTGCAGGATACGTTCAACCAGATGGGCTTG---------GAG---TATTTCAGCGAGATACTGGACGTGATCCTGAAGCCGGTGATCGATAGT---------------------------------------------------------------------------------------------------------------TCCTCTGGCTTGTTGTACGGCGATGAAAAGAAGTGGTACGGCATGATTCACGCCCGATACATCAGGTCAGAGCGTGGCCTGATTGCTATGCACCGAAAATATTTGCGAGGAGATTTTGGATCGTGTCCCAATATCTCCTGTGATAGGCAGAACACCCTGCCAGTGGGCCTCAGCGCTGTATGGGGCAAGTCAACCGTCAAGATCCACTGCCCACGGTGTAAAAGCAACTTTCATCCGAAGTCT------GATACACAGCTGGACGGAGCGATGTTCGGGCCCAGCTTCCCGGACATCTTCTTCTCGCTGCTGCCGAACTTGACATCG---------CCCCTGGACGACCCACGTACC
TRN  10010101100011001
NAM  CSK2C_YEAST/38-213
ASQ  WIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILENMTH-----------------------------ARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVP---KHPTKRY
DSQ  TGGATCGATTTATTTCTTGGGAGAAAAGGCCATGAATATTTCTGTGATGTCGATCCTGAGTACATCACTGATCGTTTTAATCTGATGAACTTGCAAAAGACAGTTTCAAAATTTTCCTACGTGGTACAATATATTGTGGATGATTTGGATGATAGTATCCTAGAGAATATGACACAT---------------------------------------------------------------------------------------GCCCGTTTAGAACAATTAGAATCAGATTCCCGGAAGCTGTATGGTCTCATCCATGCACGCTACATTATAACTATCAAAGGATTGCAAAAAATGTACGCTAAGTACAAAGAGGCGGACTTTGGAAGATGTCCCCGTGTGTATTGTAATTTACAACAGTTGTTACCGGTTGGTTTGCATGACATTCCTGGTATAGATTGTGTCAAGTTATATTGTCCATCTTGTGAGGATCTTTATATACCAAAATCATCGAGACATAGTTCCATTGATGGTGCATACTTTGGAACAAGTTTTCCAGGTATGTTTTTGCAAGCATTTCCAGATATGGTACCC---------AAACACCCAACTAAAAGATAT
TRN  10010101100011000
NAM  CSK2B_CAEEL/9-182
ASQ  WITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPDD-IE-DNA-----------------------------TNTDLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVPGEAMVKLYCPRCNMVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRP---RRPVTQF
DSQ  TGGATCACATGGTTCTGTGGCCTTCGTGGAAATGAGTTTTTCTGTGAAGTCGACGAGGAATATATTCAGGATCGGTTCAATTTGACAGGTCTCAATGAGCAAGTGCCCAAGTATCGACAGGCTCTTGACATGATTCTTGACTTAGAACCAGATGAC---ATAGAG---GATAACGCA---------------------------------------------------------------------------------------ACGAACACTGATCTTGTTGAACAAGCCGCTGAAATGCTTTATGGACTCATTCACGCTAGATATATTCTTACGAATAGAGGAATCTCACAGATGGTCGAAAAGTGGCGTGATCATGACTTTGGAGTTTGCCCACGTGTCTACTGTGAAAATCAGCCAATGCTTCCAATTGGATTGTCTGATGTTCCTGGCGAGGCTATGGTGAAATTGTACTGTCCACGTTGCAATATGGTTTTTGTTCCACGATCATCACGTCATCAACATACTGATGGAAGCTATTTTGGCACCGGATTCCCACATATGCTCTTCTTTGTTCATCCTGATCTGCGTCCA---------CGCAGACCAGTCACTCAATTC
TRN  10010101100011000
NAM  CSK2B_RAT/9-183
ASQ  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELE-DNP-----------------------------NQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRP---KRPANQF
DSQ  TGGATTTCCTGGTTCTGTGGGCTCCGTGGTAATGAATTCTTCTGTGAGGTGGATGAAGACTACATCCAGGACAAATTTAATCTTACTGGACTCAATGAGCAGGTGCCTCACTATCGACAAGCCCTAGACATGATCTTGGACCTGGAACCTGATGAAGAGCTGGAA---GACAACCCC---------------------------------------------------------------------------------------AACCAGAGTGACTTGATTGAGCAGGCGGCCGAGATGCTCTATGGGTTGATCCACGCCCGCTACATCCTCACCAACCGGGGCATTGCACAAATGTTGGAAAAGTACCAGCAAGGAGACTTTGGCTACTGTCCTCGAGTATACTGTGAGAACCAGCCGATGCTTCCCATCGGCCTTTCGGACATCCCAGGAGAGGCCATGGTGAAGCTCTACTGCCCCAAGTGCATGGACGTGTACACACCCAAGTCCTCTAGGCACCACCACACGGATGGCGCATACTTCGGCACTGGTTTCCCTCACATGCTCTTCATGGTGCATCCCGAGTACCGGCCC---------AAGCGGCCGGCCAACCAGTTT
TRN  10010101100011011
NAM  CSK2B_SCHPO/16-187
ASQ  WVDWFLGLKGNEFFCEVDEDFIQDRFNLTGLSHEVPHYSQSLDLILDVLDPD----LPE-----------------------------EVQDEVEASARHLYGLIHARYILTAQGLYKMLEKYKKCDFGHCPRVLCNGQPMLPVGLSDIAHTKSVKLYCPRCEDVYTPKSQRHASIDGAYFGTSFPHMLFQVYPELAV---PKSQERY
DSQ  TGGGTTGATTGGTTTTTAGGACTAAAAGGAAACGAATTTTTTTGCGAAGTCGACGAAGACTTCATCCAGGATCGCTTTAATTTGACTGGATTGAGTCATGAAGTTCCACACTACTCCCAGTCTTTAGACCTCATTTTAGATGTATTGGATCCTGAT------------TTACCAGAG---------------------------------------------------------------------------------------GAAGTACAAGATGAGGTAGAAGCTAGTGCTCGTCATTTGTACGGCCTTATTCACGCCCGTTATATCTTAACGGCTCAGGGTTTATATAAAATGCTTGAGAAATACAAAAAATGTGACTTTGGGCATTGCCCTAGAGTTTTATGCAACGGACAGCCAATGTTGCCCGTCGGCTTGTCGGATATTGCCCATACAAAATCCGTTAAATTATACTGTCCTCGGTGTGAGGATGTGTACACACCAAAATCACAAAGACATGCATCCATTGATGGTGCATATTTTGGAACCTCATTCCCTCACATGCTTTTTCAGGTATACCCTGAACTTGCGGTC---------CCTAAATCTCAAGAACGCTAC
TRN  10010101110011000
NAM  CSK2B_ARATH/101-275
ASQ  WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSLVPYYEYALDLILDVESSQGEM-FTE-----------------------------EQNELIESAAEMLYGLIHARYILTSKGLAAMLDKYKNYDFGRCPRVYCCGQPCLPVGQSDLPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKP---AKATQNY
DSQ  TGGATATCTTGGTTTTGTAATCTAAGAGGAAACGAGTTCTTTTGTGAAGTTGATGATGATTACATTCAAGATGACTTCAACTTGTGTGGACTCAGCAGTCTAGTTCCCTACTACGAGTACGCTCTTGATTTGATTTTGGATGTTGAATCTTCTCAAGGAGAGATG---TTTACAGAG---------------------------------------------------------------------------------------GAACAGAATGAATTGATCGAGTCAGCAGCTGAGATGTTGTATGGACTGATTCATGCTCGTTACATATTGACTAGCAAAGGATTGGCAGCAATGTTAGACAAATACAAAAACTATGACTTTGGAAGATGTCCAAGAGTTTATTGCTGTGGCCAACCTTGTCTTCCGGTTGGTCAATCAGACTTACCGCGATCTAGCACTGTGAAGATATATTGCCCGAAATGCGAAGACATTTATTACCCACGATCAAAGTATCAAGGCAACATTGATGGAGCTTACTTTGGGACAACGTTTCCACATCTGTTCCTGATGACTTATGGGCATCTCAAGCCA---------GCGAAGGCAACACAAAACTAT
TRN  10010101100011000
NAM  CSK2B_YEAST/26-233
ASQ  WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESY
DSQ  TGGATTCCATCGTTCTGTTCCAGATTTGGTCACGAGTACTTCTGCCAAGTCCCGACAGAGTTTATCGAGGATGATTTCAATATGACCTCGTTATCCCAAGAGGTACCCCACTACCGGAAAGCTCTGGATTTGATATTGGATTTGGAGGCTATGAGTGATGAAGAAGAGGACGAAGACGACGTGGTGGAAGAAGACGAAGTGGATCAAGAGATGCAGAGTAATGACGGTCATGATGAAGGCAAAAGGAGAAACAAGTCGCCAGTGGTGAACAAGAGTATTATCGAGCACGCAGCAGAACAGTTATACGGATTGATACATGCAAGATTTATTCTGACCAAGCCAGGCCTGCAAGCAATGGCTGAAAAATTCGACCACAAGGAATTTGGAACGTGCCCCCGTTACTATTGTAATGGCATGCAGTTGCTGCCTTGTGGGTTGAGCGATACAGTTGGGAAACACACCGTAAGGTTGTACTGTCCCAGTTGTCAGGACTTGTATCTTCCCCAATCATCTAGATTCCTGTGCTTAGAAGGTGCATTTTGGGGGACAAGCTTCCCTGGTGTGTTCTTGAAACATTTCAAAGAATTGGAAGAGTATGTGGAAAGGAAAAGTAAAGAGTCCTAC
TRN  10010101100011000
//