EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01205 - UPF0029)
FAM  PF01205
PID  UPF0029
DES  Uncharacterized protein family UPF0029
IPR  IPR001498
ANO  15
ALN  115
AID  0.383737
APH  (((((((Q9ZNK1_CLOHI/16-123:0.32474,YVYE_BACSU/18-125:0.31500):0.10759,(((Q9RSC2_DEIRA/21-125:0.26776,YPOL_THETH/2-103:0.21576):0.16662,Q9SZK9_ARATH/21-124:0.26454):0.11877,(Y722_HAEIN/17-126:0.14153,YIGZ_ECOLI/17-126:0.19480):0.42777):0.23457):0.09648,(O51391_BORBU/15-122:0.53026,Q9ZJD4_HELPJ/14-119:0.74540):0.20161):0.15918,Q9X238_THEMA/16-122:0.33775):0.74224,(YCU9_YEAST/143-253:0.36896,O13997_SCHPO/152-259:0.19432):0.14243):0.20662,Q9XWF4_CAEEL/137-249:0.50934):0.11723,O55091_MOUSE/180-290:0.08635,Q9W625_XENLA/178-288:0.14997);
ATP  (((((((Q9ZNK1_CLOHI/16-123,YVYE_BACSU/18-125),(((Q9RSC2_DEIRA/21-125,YPOL_THETH/2-103),Q9SZK9_ARATH/21-124),(Y722_HAEIN/17-126,YIGZ_ECOLI/17-126))),(O51391_BORBU/15-122,Q9ZJD4_HELPJ/14-119)),Q9X238_THEMA/16-122),(YCU9_YEAST/143-253,O13997_SCHPO/152-259)),Q9XWF4_CAEEL/137-249),O55091_MOUSE/180-290,Q9W625_XENLA/178-288);
ATL  7.3676
DNO  13
DLN  345
DID  0.451802
DPH  ((Q9ZNK1_CLOHI/16-123:0.23871,O51391_BORBU/15-122:0.39007):0.06134,((Q9X238_THEMA/16-122:0.47639,(((Q9W625_XENLA/178-288:0.19979,O55091_MOUSE/180-290:0.16894):0.16634,Q9XWF4_CAEEL/137-249:0.36917):0.14965,(YCU9_YEAST/143-253:0.44551,O13997_SCHPO/152-259:0.26303):0.02153):0.41250):0.07199,(YVYE_BACSU/18-125:0.28618,(Y722_HAEIN/17-126:0.37604,(Q9SZK9_ARATH/21-124:0.33954,Q9RSC2_DEIRA/21-125:0.40268):0.22624):0.15546):0.09013):0.10964,Q9ZJD4_HELPJ/14-119:0.60189);
DTP  ((Q9ZNK1_CLOHI/16-123,O51391_BORBU/15-122),((Q9X238_THEMA/16-122,(((Q9W625_XENLA/178-288,O55091_MOUSE/180-290),Q9XWF4_CAEEL/137-249),(YCU9_YEAST/143-253,O13997_SCHPO/152-259))),(YVYE_BACSU/18-125,(Y722_HAEIN/17-126,(Q9SZK9_ARATH/21-124,Q9RSC2_DEIRA/21-125)))),Q9ZJD4_HELPJ/14-119);
DTL  5.98854
RID  0.376165
RPH  (((((((Q9ZNK1_CLOHI/16-123:0.33510,YVYE_BACSU/18-125:0.31920):0.11174,((Q9RSC2_DEIRA/21-125:0.40797,Q9SZK9_ARATH/21-124:0.27962):0.17126,Y722_HAEIN/17-126:0.46695):0.21738):0.11113,(O51391_BORBU/15-122:0.54184,Q9ZJD4_HELPJ/14-119:0.75141):0.18352):0.16555,Q9X238_THEMA/16-122:0.33139):0.76642,(YCU9_YEAST/143-253:0.37293,O13997_SCHPO/152-259:0.19345):0.13652):0.21646,Q9XWF4_CAEEL/137-249:0.51233):0.12016,O55091_MOUSE/180-290:0.08920,Q9W625_XENLA/178-288:0.14868);
RTP  (((((((Q9ZNK1_CLOHI/16-123,YVYE_BACSU/18-125),((Q9RSC2_DEIRA/21-125,Q9SZK9_ARATH/21-124),Y722_HAEIN/17-126)),(O51391_BORBU/15-122,Q9ZJD4_HELPJ/14-119)),Q9X238_THEMA/16-122),(YCU9_YEAST/143-253,O13997_SCHPO/152-259)),Q9XWF4_CAEEL/137-249),O55091_MOUSE/180-290,Q9W625_XENLA/178-288);
RTL  6.93799
LNK  O13997_SCHPO/152-259:O13997:Z98978
LNK  O51391_BORBU/15-122:O51391:AE001148
LNK  O55091_MOUSE/180-290:O55091:D87973
LNK  Q9RSC2_DEIRA/21-125:Q9RSC2:AE002053
LNK  Q9SZK9_ARATH/21-124:Q9SZK9:AL035538
LNK  Q9W625_XENLA/178-288:Q9W625:AB020319
LNK  Q9X238_THEMA/16-122:Q9X238:AE001810
LNK  Q9XWF4_CAEEL/137-249:Q9XWF4:AL032654
LNK  Q9ZJD4_HELPJ/14-119:Q9ZJD4:AE001560
LNK  Q9ZNK1_CLOHI/16-123:Q9ZNK1:AB014075
LNK  Y722_HAEIN/17-126:P44842:U32755
LNK  YCU9_YEAST/143-253:P25637:X59720
LNK  YIGZ_ECOLI/17-126:P27862:
LNK  YPOL_THETH/2-103:P32438:
LNK  YVYE_BACSU/18-125:P32437:U56901
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZJD4_HELPJ/14-119
ASQ  IKASRFLGYLMPFDNFEKT---LLQLKKE--HFKAAHFVTAFRYSLEG..--KITEGFSDDGEPKGSSGMPVLSVLRREDLINIGLVSVRYFGGTLLGVGGLMKAYAKSALLCVE
DSQ  ATTAAAGCGTCTCGTTTTTTAGGGTATCTTATGCCTTTTGATAATTTTGAAAAAACC---------CTTTTGCAATTGAAAAAAGAA------CATTTTAAAGCCGCGCATTTTGTAACGGCGTTCCGCTATTCTTTAGAGGGC......------AAAATCACGGAGGGTTTTAGCGACGATGGCGAGCCTAAAGGGAGTTCAGGGATGCCTGTGCTTAGCGTTTTAAGGCGAGAGGATTTAATCAATATAGGATTAGTGAGCGTGCGTTATTTTGGAGGCACGCTTTTAGGGGTGGGGGGCTTGATGAAAGCTTATGCTAAGAGCGCGTTATTGTGTGTAGAA
TRN  10010101110011000
NAM  Q9X238_THEMA/16-122
ASQ  VKRSEFYATIFPVKDEKDFREKLKEVSKR----DATHNCWAYRIFSP-..-NGILEHSSDDGEPSGTAGRPILGALKKYDLMNTAIVVTRYFGGVKLGVRGLIEAYSSAAEMAVK
DSQ  GTTAAAAGATCGGAGTTCTATGCCACGATCTTTCCAGTAAAGGATGAAAAAGACTTTCGTGAGAAGCTGAAAGAAGTTTCGAAGAGA------------GATGCAACTCACAACTGCTGGGCTTACAGGATCTTCTCTCCA---......---AACGGTATTCTTGAACACAGTTCGGACGACGGTGAGCCGAGTGGAACGGCGGGCAGACCAATCCTCGGGGCTCTAAAAAAATACGATCTTATGAACACGGCGATCGTTGTCACAAGATATTTTGGTGGAGTGAAACTGGGTGTTCGTGGACTCATAGAAGCTTACTCTTCGGCCGCTGAGATGGCGGTCAAG
TRN  10010101100011011
NAM  YVYE_BACSU/18-125
ASQ  IEKSRFICHLSRVSTEQEAQEFIQKIKKQ--HWNATHNCSAYVIGE--..-NDHIQKANDDGEPSGTAGVPMLEVLKKRRLKDTCAVVTRYFGGIKLGAGGLIRAYGKSVSEGLN
DSQ  ATAGAAAAATCGCGTTTTATCTGTCATTTAAGCCGTGTTTCTACCGAACAAGAGGCACAGGAATTTATACAGAAAATAAAGAAACAG------CACTGGAATGCGACTCATAATTGCTCGGCTTATGTTATTGGCGAG------......---AATGATCATATCCAAAAAGCCAATGATGACGGGGAACCAAGCGGTACAGCGGGAGTGCCGATGCTCGAGGTTTTAAAAAAACGCAGGCTGAAGGATACTTGCGCCGTCGTTACACGCTACTTCGGAGGCATTAAGCTTGGTGCTGGCGGATTAATTCGCGCTTATGGGAAATCAGTGTCTGAAGGATTAAAT
TRN  10010101100011000
NAM  Q9ZNK1_CLOHI/16-123
ASQ  EKKSIFIGHVKRVNSEEEAKQFIEEIKEK--YKDARHNVYAYIIGE--..-NMGIQRYSDDGEPKGTGGIPILEVIKKNNITDTVVVVTRYFGGILLGASGLTRAYSKAAVNAIK
DSQ  GAAAAAAAATCTATTTTTATAGGACACGTAAAAAGGGTGAATTCTGAAGAGGAAGCAAAACAGTTTATTGAAGAAATTAAAGAAAAA------TATAAGGATGCAAGGCATAATGTCTATGCATATATTATCGGTGAA------......---AACATGGGTATACAAAGATATAGTGATGATGGAGAACCAAAAGGCACAGGTGGTATACCAATACTAGAAGTAATTAAGAAAAATAATATAACGGATACAGTAGTTGTAGTAACTAGATACTTTGGCGGTATACTGCTAGGGGCATCGGGACTTACCAGAGCGTACTCTAAAGCTGCTGTAAATGCTATTAAA
TRN  10010101100011011
NAM  YIGZ_ECOLI/17-126
ASQ  IKKSRFITMLAHTDGVEAAKAFVESVRAE--HPDARHHCVAWVAGAPD..-DSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALR
NAM  Y722_HAEIN/17-126
ASQ  IKKSRFITYLQHTEGLEDARAFWAKIKQE--HPNARHHCWAAVAGKPT..-DSLQLGFSDDGEPAGTAGKPMLSALQGSQLGEISAVVVRYYGGILLGTGGLVRAYGNGVQQALK
DSQ  ATTAAGAAAAGCCGTTTTATTACTTATTTACAGCACACCGAAGGTTTAGAAGACGCAAGAGCTTTTTGGGCAAAGATTAAACAAGAA------CATCCAAATGCTCGGCATCATTGTTGGGCTGCCGTAGCAGGCAAGCCAACA......---GATTCTCTACAACTTGGTTTTTCTGATGATGGCGAACCTGCTGGAACGGCAGGAAAGCCAATGTTGAGTGCATTGCAAGGCAGTCAATTAGGTGAAATCAGTGCGGTGGTGGTTCGCTATTATGGCGGTATTTTGCTTGGAACGGGCGGATTAGTTCGTGCTTACGGCAATGGTGTTCAACAAGCGTTAAAG
TRN  10010101110011010
NAM  Q9SZK9_ARATH/21-124
ASQ  IKKSKFIAIAGPISSEQSAQMFLSQVRD----PRASHNCWAYKIGD--..---HHHRCSDDGEPSGTAGKPIQSAILSSGLDRVMVVVIRYFGGIKLGTGGLVRAYGGVTSDCLK
DSQ  ATAAAGAAGAGCAAGTTCATCGCAATCGCTGGACCAATCTCCTCCGAGCAATCAGCTCAAATGTTCCTCTCTCAGGTCCGTGAT------------CCTCGCGCTTCTCACAATTGCTGGGCTTATAAGATCGGTGAT------......---------CATCACCATCGATGTAGCGATGATGGTGAGCCATCTGGCACAGCAGGGAAGCCGATTCAGTCTGCTATTCTCTCTTCTGGATTAGACAGAGTTATGGTTGTTGTCATTAGGTATTTTGGGGGAATCAAACTTGGAACTGGAGGTCTTGTTAGAGCATATGGTGGTGTTACATCTGATTGCTTGAAA
TRN  10010101110011000
NAM  YPOL_THETH/2-103
ASQ  IQRSRFLAKAAPAASEEEALAFLAAHRE----PQATHNAYAYRIG---..---PLYRFSDDGEPR-APGRPILHAIEAAGLDRVVVLVVRYFGGVKLGAGGLVRAYGGVAAEALR
NAM  Q9RSC2_DEIRA/21-125
ASQ  IDHSEFLAFAERADSPEEALAHLAALRTR--YPDATHHCWAYRIG---..---AAYRFGDDGEPGGTAGAPILRAIEGQGVDHVMVVVVRYYGGVKLGTGGLVRAYGGVAAECLR
DSQ  ATTGACCATTCCGAATTCCTCGCCTTCGCGGAGCGCGCCGACTCGCCGGAAGAGGCGCTGGCACACCTCGCGGCGCTGCGGACCCGT------TACCCCGACGCCACCCACCACTGCTGGGCCTACCGCATCGGC---------......---------GCGGCGTACCGCTTCGGCGACGACGGCGAACCGGGCGGCACGGCGGGGGCGCCTATCCTGCGGGCCATCGAGGGGCAGGGCGTGGACCACGTGATGGTCGTGGTCGTGCGCTACTACGGTGGCGTCAAGCTCGGCACCGGGGGGCTGGTGCGGGCCTACGGCGGCGTGGCGGCGGAGTGCCTGCGG
TRN  11011111101111111
NAM  O51391_BORBU/15-122
ASQ  IKKSIFVSYIFNIEKKDDINKTIKKYKIK--FKNATHVVYGFRIGNK-..-NSFLNGMSDDREPNLTAGKPTLDAIIHNNLTDTLIITLRYFGGTLLGRGGLIKAYYKSAKEVI-
DSQ  ATAAAGAAATCCATCTTTGTTTCATATATTTTTAATATTGAAAAAAAAGACGATATAAATAAAACTATTAAAAAATACAAAATAAAA------TTTAAAAATGCTACGCATGTGGTTTATGGATTTAGAATCGGAAACAAA---......---AACTCATTTCTAAATGGAATGAGTGATGATCGAGAACCTAATTTAACAGCTGGAAAGCCCACATTGGATGCCATAATACATAACAATTTAACCGATACTTTAATAATCACATTGCGATATTTTGGAGGCACTTTACTTGGTAGAGGGGGATTAATCAAAGCGTATTACAAGTCTGCCAAAGAAGTTATT---
TRN  10010101110011000
NAM  Q9XWF4_CAEEL/137-249
ASQ  DRKSAFQAHLAEVRSKEDVDRVMRILKSNTKICRATHNITAYRYMTEIngKPIHHHDCVDDGEFG--ASSKMLELMDRMKADNVMVVVSRWYGGIHLGPDRFRHINNLTRQILSD
DSQ  GACCGGAAAAGTGCATTTCAGGCTCATTTGGCCGAGGTTCGGAGTAAGGAAGATGTGGATCGAGTGATGCGAATCCTTAAATCGAATACAAAAATCTGCCGGGCAACACATAATATTACAGCATATCGATATATGACTGAAATCaatggaAAACCAATTCATCATCATGATTGTGTGGATGATGGGGAATTTGGA------GCAAGTTCGAAAATGTTAGAGCTCATGGATCGAATGAAAGCGGATAATGTGATGGTCGTCGTTTCACGTTGGTACGGTGGAATTCATCTTGGACCCGATCGTTTTCGACATATTAATAATTTAACTCGGCAAATTTTAAGTGAT
TRN  11011101111011000
NAM  Q9W625_XENLA/178-288
ASQ  DRRSTFQAHLAPVVSPYQVKLILNKLYENKKIATATHNIYAYRIYIKE..RNSFIQDCEDDGETA--AGKRMLHLMQILDARDVMVVVSRWYGGILLGPDRFKHINNCARNVLME
DSQ  GACAGAAGAAGTACATTTCAGGCCCATTTGGCTCCTGTAGTCAGCCCTTACCAGGTCAAGCTGATACTGAATAAGCTCTATGAGAACAAGAAAATAGCTACAGCTACGCACAATATTTATGCATATAGGATATATATCAAAGAG......CGAAATTCTTTTATACAAGATTGCGAGGATGATGGTGAAACCGCA------GCAGGAAAACGAATGCTCCACCTCATGCAGATATTGGATGCACGTGATGTCATGGTAGTGGTTTCACGCTGGTATGGAGGTATCCTCCTTGGACCCGATCGCTTTAAACATATCAACAACTGTGCAAGAAATGTATTAATGGAA
TRN  10010101100011000
NAM  O55091_MOUSE/180-290
ASQ  DRRSTFQAHVAPVVCPEQVKLVLAKLYENKKIASATHNIYAYRIFCED..KQTFLQDCEDDGETA--AGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVE
DSQ  GACCGAAGGAGCACTTTTCAGGCTCATGTGGCCCCTGTCGTCTGTCCTGAGCAGGTGAAACTGGTTCTTGCCAAGCTGTACGAGAATAAGAAGATTGCCAGCGCCACCCACAACATCTATGCCTACAGGATATTCTGTGAGGAT......AAACAGACCTTCTTGCAGGACTGTGAAGATGATGGAGAAACAGCT------GCTGGGGGCCGCCTTCTTCACCTCATGGAGATTTTGAATGTGAAGAATGTCATGGTGGTGGTGTCCCGCTGGTATGGAGGGATCCTGCTGGGACCTGACCGTTTCAAACACATCAACAACTGTGCCAGGAACATTCTGGTGGAG
TRN  10010101100011011
NAM  O13997_SCHPO/152-259
ASQ  DRKSTFMAHATRVYSTEEVREALEDLYMDKKVAKANHNMVAYRIISP-..NGNVIQDNDDDGESA--AGSRMSHLLTMMSAENVFVCVSRWFGGVHIGPDRFKHINSSAREAV--
DSQ  GATCGAAAAAGCACCTTTATGGCTCATGCAACGCGTGTTTATTCTACAGAAGAAGTTCGCGAAGCTCTCGAAGATTTGTATATGGATAAAAAAGTTGCAAAGGCGAATCATAATATGGTAGCATATCGGATTATTTCCCCA---......AACGGGAACGTTATTCAGGATAATGATGATGACGGAGAATCAGCT------GCTGGTTCTCGTATGAGTCATTTGCTAACTATGATGTCTGCCGAAAATGTTTTTGTTTGCGTTTCACGTTGGTTTGGGGGCGTTCACATCGGACCAGACAGATTCAAACATATAAACTCATCGGCTCGTGAAGCAGTA------
TRN  10010101110011001
NAM  YCU9_YEAST/143-253
ASQ  DRGSTFMAFAAHVTSEEQAFAMLDLLKTDSKMRKANHVMSAWRIKQDG..SAATYQDSDDDGETA--AGSRMLHLITIMDVWNVIVVVARWFGGAHIGPDRFKHINSTAREAVVR
DSQ  GATAGAGGCTCGACTTTCATGGCCTTTGCAGCACATGTTACCTCCGAGGAACAAGCGTTTGCCATGCTAGACCTACTGAAGACCGACTCCAAGATGCGTAAGGCAAACCATGTCATGAGTGCATGGCGAATCAAGCAGGATGGC......TCTGCGGCAACATATCAAGATTCCGATGATGACGGTGAAACGGCC------GCCGGCTCCAGAATGCTGCACCTCATCACCATCATGGATGTGTGGAACGTCATCGTTGTGGTGGCCCGTTGGTTCGGCGGTGCCCACATAGGTCCCGACCGGTTTAAACACATCAATTCTACGGCAAGAGAAGCTGTTGTCAGG
TRN  10010101100011011
//