EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01188 - MR_MLE)
FAM  PF01188
PID  MR_MLE
DES  Mandelate racemase / muconate lactonizing enzyme, C-terminal domain
IPR  IPR001354
ANO  7
ALN  275
AID  0.330908
APH  (TFDD1_ALCEU/128-367:0.21789,(CLCB_PSEPU/128-367:0.15937,TCBD_PSESQ/128-367:0.13289):0.10547,((MANR_PSEPU/131-358:1.05643,(RSPA_ECOLI/113-385:0.34153,YIN2_STRAM/114-383:0.12219):1.21372):0.61431,CATB_PSEPU/133-372:0.43061):0.36359);
ATP  (TFDD1_ALCEU/128-367,(CLCB_PSEPU/128-367,TCBD_PSESQ/128-367),((MANR_PSEPU/131-358,(RSPA_ECOLI/113-385,YIN2_STRAM/114-383)),CATB_PSEPU/133-372));
ATL  4.758
DNO  7
DLN  825
DID  0.459588
DPH  ((((TCBD_PSESQ/128-367:0.11395,(CLCB_PSEPU/128-367:0.19362,TFDD1_ALCEU/128-367:0.28990):0.06959):0.21947,CATB_PSEPU/133-372:0.40019):0.17673,MANR_PSEPU/131-358:0.73005):0.55426,RSPA_ECOLI/113-385:0.37902,YIN2_STRAM/114-383:0.15501);
DTP  ((((TCBD_PSESQ/128-367,(CLCB_PSEPU/128-367,TFDD1_ALCEU/128-367)),CATB_PSEPU/133-372),MANR_PSEPU/131-358),RSPA_ECOLI/113-385,YIN2_STRAM/114-383);
DTL  3.28179
RID  0.330908
RPH  (TFDD1_ALCEU/128-367:0.21789,(CLCB_PSEPU/128-367:0.15937,TCBD_PSESQ/128-367:0.13289):0.10547,((MANR_PSEPU/131-358:1.05643,(RSPA_ECOLI/113-385:0.34153,YIN2_STRAM/114-383:0.12219):1.21372):0.61431,CATB_PSEPU/133-372:0.43061):0.36359);
RTP  (TFDD1_ALCEU/128-367,(CLCB_PSEPU/128-367,TCBD_PSESQ/128-367),((MANR_PSEPU/131-358,(RSPA_ECOLI/113-385,YIN2_STRAM/114-383)),CATB_PSEPU/133-372));
RTL  4.758
LNK  CATB_PSEPU/133-372:P08310:M19460
LNK  CLCB_PSEPU/128-367:P11452:M16964
LNK  MANR_PSEPU/131-358:P11444:M19043
LNK  RSPA_ECOLI/113-385:P38104:L31628
LNK  TCBD_PSESQ/128-367:P27099:M57629
LNK  TFDD1_ALCEU/128-367:P05404:M35097
LNK  YIN2_STRAM/114-383:P32426:X70975
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YIN2_STRAM/114-383
ASQ  SRDGV-LVYSHASGTDVPSLLDDVERHLELGYKAVRAQAAVPGVGGTYGVRKGR--VYEPAAS.ELPDEQPWDTEAYLDFAPRYLEAVRERFGFGFHLLHDVHHRLTPNEAARFGKSVEASRLFWMEDPTPAENQESFRLIRQHTTTPIAVGEVMNSIWDVQHLITEQLIDYVRTTVVHAGGITHLRRIFDLAALHQVRTGSHGATDLSPVSMAAAVHLDIAVPNFG-IQEYMGHADETAEVFRTGVTFADGMLHPSDEPGLGVEYDEKAAERFP
DSQ  TCGCGCGACGGCGTA---CTGGTCTACTCGCACGCCAGCGGCACCGACGTACCCTCGCTTCTCGACGACGTCGAGCGCCACCTGGAGCTGGGCTACAAGGCGGTACGGGCGCAGGCGGCCGTGCCCGGCGTCGGGGGCACGTACGGGGTGCGCAAGGGCAGG------GTCTACGAGCCGGCCGCCTCC...GAACTGCCCGACGAACAGCCCTGGGACACCGAGGCCTACCTCGACTTCGCGCCCAGGTACCTGGAAGCGGTACGGGAACGCTTCGGCTTCGGCTTCCACCTCCTGCACGACGTGCACCACCGGCTCACCCCGAACGAGGCGGCCCGGTTCGGCAAGAGCGTCGAGGCCTCCCGGCTGTTCTGGATGGAGGACCCGACCCCGGCCGAGAACCAGGAGTCCTTCCGGCTCATCCGGCAGCACACCACGACACCGATCGCGGTCGGCGAGGTGATGAACTCGATCTGGGACGTCCAGCACCTCATCACCGAACAGCTCATCGACTACGTGCGCACCACCGTCGTCCACGCGGGCGGCATCACCCATCTGCGCCGGATCTTCGACCTCGCCGCACTCCACCAGGTGCGGACCGGATCCCACGGTGCGACCGACCTCTCGCCCGTGAGCATGGCCGCCGCCGTGCACCTGGACATCGCCGTGCCGAACTTCGGC---ATCCAGGAGTACATGGGCCACGCCGACGAGACCGCCGAGGTGTTCCGCACCGGGGTGACCTTCGCCGACGGCATGCTCCACCCCTCCGACGAGCCGGGCCTCGGCGTCGAGTACGACGAGAAGGCGGCCGAACGCTTCCCC
TRN  10010101100011011
NAM  RSPA_ECOLI/113-385
ASQ  SREGV-MVYCHTTGHSIDEALDDYARHQELGFKAIRVQCGIPGMKTTYGMSKGKGLAYEPATKgQWPEEQLWSTEKYLDFMPKLFDAVRNKFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRMFWMEDPTPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRIADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFG-VQEYMGYSEQMLEVFPHNWTFDNGYMHPGDKPGLGIEFDEKLAAKYP
DSQ  TCTCGTGAAGGGGTG---ATGGTTTATTGCCATACCACCGGTCACAGTATTGATGAAGCTCTGGATGATTATGCCCGTCATCAAGAGCTTGGATTCAAAGCCATCCGCGTGCAGTGCGGAATCCCTGGTATGAAAACCACCTACGGCATGTCGAAAGGTAAAGGTCTGGCTTATGAACCCGCAACCAAAggaCAGTGGCCGGAAGAGCAGCTGTGGTCGACGGAGAAATACCTCGATTTCATGCCGAAATTGTTTGACGCGGTACGTAACAAGTTTGGTTTTAATGAACATTTGCTGCATGACATGCACCATCGCTTAACGCCTATTGAAGCGGCGCGCTTTGGTAAAAGCATTGAAGATTATCGCATGTTCTGGATGGAAGACCCGACGCCTGCGGAAAACCAGGAATGCTTCCGTCTCATTCGCCAACATACCGTCACACCCATCGCAGTGGGTGAAGTCTTCAACAGCATCTGGGACTGCAAACAACTGATTGAAGAGCAACTCATCGATTATATCCGCACCACGCTGACCCATGCAGGCGGAATTACCGGTATGCGCCGGATTGCCGATTTTGCTTCGCTGTATCAGGTACGTACTGGCTCACACGGTCCTTCCGATTTGTCACCAGTCTGCATGGCTGCGGCGCTGCACTTTGATCTGTGGGTCCCCAATTTCGGT---GTCCAGGAATACATGGGTTATTCCGAACAAATGCTCGAAGTCTTCCCGCACAACTGGACTTTCGATAACGGCTATATGCATCCGGGAGACAAACCGGGTCTTGGTATCGAATTCGATGAAAAGCTGGCGGCGAAATATCCC
TRN  11011101101011000
NAM  TFDD1_ALCEU/128-367
ASQ  LRSAIPIAWTLASG--------DTKRDLDSAVEMIERRRHN-RFKVKLGFRSPQ---------.-------------DDLIH--MEALSNSLGSKAYLRVDVNQAWDEQVASVYIPELEALGVELIEQPVGRENTQALRRLSDNNRVAIMADESLSTLASAFDLARDRSVDVFSLKLCNMGGVSATQKIAAVAEASGIASYG-GTMLDSTIGTSVALQLYSTVPSLPFGCELIGPFVLADTLSHEPLEIRDYELQVPTGVGHGMTLDEDKVRQYA
DSQ  TTGCGCAGTGCGATTCCGATTGCCTGGACATTGGCGAGCGGA------------------------GATACGAAACGCGATCTCGATTCTGCCGTCGAGATGATTGAAAGACGACGACACAAT---CGCTTCAAAGTCAAGCTTGGCTTCCGGTCGCCCCAA---------------------------...---------------------------------------GACGATCTCATCCAT------ATGGAGGCTTTGTCAAATAGTCTCGGATCGAAGGCCTACCTTCGCGTTGACGTGAATCAGGCTTGGGACGAGCAAGTGGCGTCCGTCTACATTCCTGAACTGGAGGCGCTTGGCGTGGAACTCATCGAACAGCCGGTCGGCCGCGAAAATACGCAAGCGTTGAGGCGGCTCTCCGACAACAACCGCGTGGCCATCATGGCCGATGAGAGCCTGAGTACGTTGGCCTCGGCATTCGATCTCGCGCGCGACCGAAGTGTGGATGTCTTTTCGCTGAAGCTTTGCAACATGGGAGGGGTCTCGGCGACGCAAAAGATAGCAGCGGTCGCGGAAGCAAGCGGGATTGCATCGTATGGC---GGAACAATGCTTGACTCGACGATCGGCACATCGGTTGCACTTCAGCTCTATTCTACGGTTCCATCGCTTCCGTTCGGTTGCGAACTGATCGGTCCCTTCGTGTTGGCAGACACGCTGAGCCACGAGCCACTCGAGATCCGGGATTACGAACTGCAGGTTCCCACTGGCGTAGGTCACGGCATGACGCTTGACGAGGACAAGGTGCGCCAATACGCA
TRN  10010101100011001
NAM  TCBD_PSESQ/128-367
ASQ  MRTSIPIAWTLASG--------DTARDIDSALEMIETRRHN-RFKVKLGARTPA---------.-------------QDLEH--IRSIVKAVGDRASVRVDVNQGWDEQTASIWIPRLEEAGVELVEQPVPRANFGALRRLTEQNGVAILADESLSSLSSAFELARDHAVDAFSLKLCNMGGIANTLKVAAVAEAAGISSYG-GTMLDSTVGTAAALHVYATLPSLPYGCELIGPWVLGDRLTQQDLEIKDFEVHLPLGSGLGVDLDHDKVRHYT
DSQ  ATGCGGACCAGCATCCCGATCGCATGGACACTTGCGAGCGGC------------------------GACACCGCCCGGGACATCGACTCGGCGCTCGAGATGATCGAGACGCGACGGCACAAT---CGCTTCAAGGTGAAGCTCGGCGCGCGCACGCCGGCT---------------------------...---------------------------------------CAGGATCTGGAGCAC------ATCCGCAGCATCGTGAAGGCCGTGGGCGACAGGGCTTCCGTGCGTGTCGACGTAAACCAGGGATGGGACGAGCAGACCGCTTCGATCTGGATTCCGCGGCTTGAAGAAGCGGGCGTGGAACTGGTCGAGCAGCCCGTGCCTCGCGCGAATTTCGGGGCCCTTCGGCGTTTGACCGAACAAAACGGGGTGGCGATCCTTGCCGATGAGAGCCTCAGCTCGCTGTCGTCGGCATTCGAGCTGGCCCGCGACCACGCGGTGGACGCGTTCTCGCTGAAGCTTTGCAACATGGGCGGCATCGCGAACACGCTAAAGGTCGCGGCGGTCGCGGAAGCAGCGGGCATTTCCTCCTATGGC---GGAACGATGCTGGACTCCACGGTCGGCACAGCAGCTGCACTGCACGTGTACGCGACATTGCCTTCCCTGCCCTACGGATGCGAGTTGATCGGCCCTTGGGTTCTTGGTGACCGCCTGACCCAGCAGGACCTCGAGATCAAGGACTTCGAAGTGCACCTGCCGCTGGGAAGCGGGCTTGGCGTGGACCTAGACCACGACAAGGTCCGTCACTACACA
TRN  10010101100011011
NAM  CLCB_PSEPU/128-367
ASQ  IQQGIPIAWTLASG--------DTQRDIAIAEEMIERRRHN-RFKIKLGVRSPA---------.-------------DDLRH--IEKIIERVGDRAAVRVDINQAWDENTASVWIPRLEAAGVELVEQPVARSNFDALRRLSADNGVAILADESLSSLASAFELARHHCVDAFSLKLCNMGGVANTLKVAAIAEASGIASYG-GTMLDSSIGTAAALHVYATLPTMPFECELLGPWVLADTLTQTQLEIKDFEIRLPSGPGLGVDIDPDKLRHFT
DSQ  ATCCAGCAGGGCATCCCCATTGCCTGGACCCTGGCGAGCGGC------------------------GACACGCAGCGGGACATCGCAATCGCCGAGGAAATGATCGAGCGGCGCCGGCACAAC---CGGTTCAAGATCAAGCTTGGCGTGCGCTCCCCGGCA---------------------------...---------------------------------------GATGATTTGCGCCAT------ATCGAGAAGATTATCGAGCGCGTCGGTGACCGTGCTGCGGTGCGGGTCGATATCAACCAGGCCTGGGATGAGAACACGGCATCGGTGTGGATTCCGCGCCTGGAGGCGGCCGGTGTCGAACTGGTCGAACAGCCGGTGGCACGCAGCAACTTCGATGCGCTTCGGCGCCTGTCGGCCGACAACGGGGTGGCCATCCTGGCCGATGAAAGCCTGAGCTCGCTGGCGTCCGCCTTCGAACTGGCGCGCCATCATTGCGTCGACGCCTTCTCGCTGAAGCTGTGCAACATGGGCGGGGTGGCAAATACCCTCAAGGTCGCTGCGATCGCGGAAGCCTCGGGCATTGCGTCCTATGGG---GGCACCATGTTGGATTCATCAATCGGCACCGCTGCTGCTCTCCATGTGTATGCCACATTGCCGACGATGCCCTTCGAATGTGAACTGCTAGGGCCCTGGGTGTTAGCCGACACGCTTACGCAGACCCAACTCGAGATCAAGGACTTCGAGATTCGGTTGCCCTCGGGTCCTGGGTTGGGTGTTGATATCGATCCGGACAAGCTGCGCCACTTCACC
TRN  11011111101111100
NAM  CATB_PSEPU/133-372
ASQ  VRDSLEVAWTLASG--------DTARDIAEAQHMLEIRRHR-VFKLKIGANPLA---------.-------------QDLKH--VVAIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRSGQVRLNQRSPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIALYG-GTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFA
DSQ  GTGCGCGACAGCCTGGAAGTGGCCTGGACCTTGGCCAGCGGC------------------------GATACCGCCCGGGACATCGCCGAAGCCCAGCACATGCTGGAGATTCGTCGGCATCGG---GTGTTCAAGCTGAAGATTGGCGCCAACCCGTTGGCC---------------------------...---------------------------------------CAGGACCTAAAGCAC------GTGGTGGCGATCAAGCGCGAGCTGGGCGACAGCGCCAGCGTGCGGGTCGACGTCAACCAGTACTGGGACGAATCCCAGGCCATCCGTGCCTGCCAGGTGCTTGGCGACAACGGCATCGACCTGATCGAGCAACCGATTTCGCGTATCAACCGCAGCGGCCAGGTACGCCTGAACCAGCGCAGCCCGGCACCGATCATGGCCGACGAGTCGATCGAAAGCGTCGAGGACGCCTTCAGCCTGGCTGCCGACGGCGCGGCCAGCATCTTCGCCCTGAAAATAGCCAAGAACGGCGGCCCGCGGGCCGTACTGCGTACCGCGCAAATCGCCGAGGCTGCCGGCATCGCCTTGTATGGC---GGGACCATGCTCGAAGGCTCGATCGGCACCCTGGCTTCGGCTCATGCCTTCCTGACCCTGCGCCAGCTCACCTGGGGCACCGAGCTGTTCGGGCCGCTGCTGCTGACCGAAGAAATCGTCAACGAGCCGCCGCAATACCGCGACTTCCAGCTGCACATTCCACGTACCCCAGGCCTGGGCCTGACCCTGGACGAACAGCGCCTGGCGCGCTTCGCC
TRN  10010101100011011
NAM  MANR_PSEPU/131-358
ASQ  ARPVQAYDSHSLDG---------VKLATERAVTAAELGFRA--VKTKIGYPALD---------.-------------QDLAV--VRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSS---HLF----QEISAHLLAATPTAH----WLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYL
DSQ  GCTCGACCAGTTCAGGCTTATGACAGCCACAGCTTGGATGGA---------------------------GTCAAACTCGCGACTGAGCGCGCTGTGACCGCAGCAGAACTCGGATTCCGGGCG------GTTAAGACCAAGATCGGCTATCCGGCATTGGAT---------------------------...---------------------------------------CAAGATCTGGCAGTC------GTGCGCAGCATACGCCAAGCAGTAGGTGACGACTTCGGCATCATGGTCGACTACAACCAGAGTTTGGATGTACCAGCCGCAATCAAACGCAGCCAGGCGCTGCAGCAAGAGGGCGTCACCTGGATTGAAGAGCCGACGCTTCAACACGATTACGAAGGCCATCAGCGCATTCAAAGCAAGCTCAATGTGCCCGTCCAGATGGGTGAGAACTGGCTCGGCCCTGAGGAGATGTTCAAAGCATTGAGCATCGGTGCATGCCGGTTGGCTATGCCAGATGCAATGAAGATCGGTGGCGTGACGGGCTGGATCCGAGCCAGTGCACTCGCACAACAATTCGGTATTCCAATGTCCAGC---------CACCTGTTC------------CAAGAAATCAGCGCTCACCTGCTAGCCGCCACCCCAACTGCGCAT------------TGGCTGGAGCGTTTGGATCTCGCCGGCAGCGTCATCGAGCCTACTCTTACATTTGAGGGCGGAAATGCTGTGATTCCGGATCTCCCTGGCGTTGGGATCATCTGGCGCGAGAAAGAAATCGGGAAATATCTG
TRN  10010101100011011
//