EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01176 - eIF-1a)
FAM  PF01176
PID  eIF-1a
DES  Eukaryotic initiation factor 1A
IPR  IPR001253
ANO  5
ALN  102
AID  0.467048
APH  (IF1A_YEAST/13-113:0.11013,(IF1AX_HUMAN/12-112:0.09662,IF1A_WHEAT/12-112:0.21101):0.19571,(IF1A_THEAC/15-115:0.39711,IF1A_METJA/1-102:0.42020):1.04920);
ATP  (IF1A_YEAST/13-113,(IF1AX_HUMAN/12-112,IF1A_WHEAT/12-112),(IF1A_THEAC/15-115,IF1A_METJA/1-102));
ATL  2.47998
DNO  4
DLN  306
DID  0.490649
DPH  (IF1A_YEAST/13-113:0.22673,IF1AX_HUMAN/12-112:0.28804,(IF1A_THEAC/15-115:0.36837,IF1A_METJA/1-102:0.35401):0.53639);
DTP  (IF1A_YEAST/13-113,IF1AX_HUMAN/12-112,(IF1A_THEAC/15-115,IF1A_METJA/1-102));
DTL  1.77354
RID  0.430735
RPH  (IF1A_YEAST/13-113:0.10397,IF1AX_HUMAN/12-112:0.27926,(IF1A_THEAC/15-115:0.40300,IF1A_METJA/1-102:0.42229):1.05841);
RTP  (IF1A_YEAST/13-113,IF1AX_HUMAN/12-112,(IF1A_THEAC/15-115,IF1A_METJA/1-102));
RTL  2.26693
LNK  IF1A_METJA/1-102:Q57887:U67496
LNK  IF1A_THEAC/15-115:Q03590:X68198
LNK  IF1A_WHEAT/12-112:P47815:
LNK  IF1AX_HUMAN/12-112:P47813:L18960
LNK  IF1A_YEAST/13-113:P38912:U11585
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IF1A_YEAST/13-113
ASQ  RRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQ-DDQCDVVHKYNLDEARTLKNQGELPENA
DSQ  AGAAGAGGTAAGAACGACTCTGACGGTCCAAAGCGTGAACTTATTTATAAGGAAGAAGGCCAAGAATATGCTCAAATCACCAAGATGTTGGGTAATGGAAGAGTCGAAGCCAGTTGCTTTGATGGTAATAAGAGAATGGCCCATATTAGAGGTAAGTTAAGAAAGAAAGTCTGGATGGGACAAGGTGATATTATTCTTGTTTCCTTAAGAGATTTCCAA---GATGACCAATGTGATGTTGTCCACAAATATAATTTAGATGAAGCCAGAACACTGAAAAACCAAGGTGAACTTCCTGAAAACGCC
TRN  10010101100011010
NAM  IF1A_WHEAT/12-112
ASQ  KRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCHIRGKMHKKVWIAAGDIVLVGLRDYQ-DDKADVILKYMNDEARLLKAYGELPDTV
NAM  IF1AX_HUMAN/12-112
ASQ  RRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQ-DNKADVILKYNADEARSLKAYGELPEHA
DSQ  CGCAGGGGTAAGAATGAGAATGAATCTGAAAAAAGAGAACTGGTATTCAAAGAGGATGGGCAGGAGTATGCTCAGGTAATCAAAATGTTGGGAAATGGACGGCTAGAAGCAATGTGTTTCGATGGTGTAAAGAGGTTATGTCACATCAGAGGAAAATTGAGAAAAAAGGTTTGGATAAATACCTCGGACATTATTTTGGTTGGTCTCCGAGACTACCAG---GATAACAAAGCTGATGTAATTTTAAAATACAATGCAGACGAAGCTAGAAGTCTGAAGGCATACGGCGAGCTTCCAGAGCATGCT
TRN  10010101100011010
NAM  IF1A_METJA/1-102
ASQ  MAEQQQEQQIRVRIPRKEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIWVREGDVVIVKPWEVQGDQKCDIIWRYTKTQVEWLKRKGYLDELL
DSQ  ATGGCTGAACAGCAACAAGAACAGCAAATTAGAGTAAGAATTCCAAGAAAAGAAGAGAATGAGATTTTGGGGATTATAGAGCAGATGTTGGGAGCAAGTAGGGTTAGAGTTAGATGCTTAGACGGAAAAACAAGATTGGGAAGAATCCCTGGCAGATTAAAGAATAGAATTTGGGTTAGAGAAGGAGATGTAGTTATTGTAAAACCATGGGAAGTTCAAGGAGACCAGAAGTGTGATATCATTTGGAGATACACAAAAACACAAGTTGAATGGCTTAAAAGAAAAGGTTATTTAGATGAGTTACTA
TRN  10010101110011010
NAM  IF1A_THEAC/15-115
ASQ  SGEENEESIGRVILPNKKKGEMFGIVEKMEGASRLSVMCEDGYTRNARIPGRMRKRMWIREKDLVIVKPWEFQ-PEKADVVYRYTKTQASYLSRNHMLPEVI
DSQ  AGCGGCGAAGAGAACGAGGAATCGATAGGGCGAGTTATACTCCCAAACAAGAAGAAGGGGGAGATGTTCGGTATCGTTGAGAAGATGGAGGGTGCATCCAGGCTCTCCGTAATGTGCGAGGACGGATACACCAGGAATGCGAGGATACCCGGGCGCATGCGCAAGCGCATGTGGATAAGGGAAAAGGATCTTGTTATAGTCAAACCATGGGAATTCCAG---CCTGAGAAGGCCGACGTTGTCTACCGTAATACGAAAACACAGGCAAGCTACCTCAGCAGGAATCACATGCTGCCGGAGGTCATA
TRN  10010101100011011
//