EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01174 - SNO)
FAM  PF01174
PID  SNO
DES  SNO glutamine amidotransferase family
IPR  IPR002161
ANO  5
ALN  211
AID  0.417439
APH  (YFG0_YEAST/7-217:0.19445,(Y1661_METJA/5-185:0.51114,(YAAE_BACSU/6-189:0.42870,Y1648_HAEIN/1-174:0.69907):0.15098):0.65057,YMY5_YEAST/18-223:0.21924);
ATP  (YFG0_YEAST/7-217,(Y1661_METJA/5-185,(YAAE_BACSU/6-189,Y1648_HAEIN/1-174)),YMY5_YEAST/18-223);
ATL  2.85415
DNO  5
DLN  633
DID  0.490327
DPH  ((YFG0_YEAST/7-217:0.22678,YMY5_YEAST/18-223:0.26178):0.39972,(YAAE_BACSU/6-189:0.39320,Y1648_HAEIN/1-174:0.50713):0.12128,Y1661_METJA/5-185:0.32156);
DTP  ((YFG0_YEAST/7-217,YMY5_YEAST/18-223),(YAAE_BACSU/6-189,Y1648_HAEIN/1-174),Y1661_METJA/5-185);
DTL  2.23145
RID  0.417439
RPH  (YFG0_YEAST/7-217:0.19445,(Y1661_METJA/5-185:0.51114,(YAAE_BACSU/6-189:0.42870,Y1648_HAEIN/1-174:0.69907):0.15098):0.65057,YMY5_YEAST/18-223:0.21924);
RTP  (YFG0_YEAST/7-217,(Y1661_METJA/5-185,(YAAE_BACSU/6-189,Y1648_HAEIN/1-174)),YMY5_YEAST/18-223);
RTL  2.85415
LNK  Y1648_HAEIN/1-174:P45294:U32837
LNK  Y1661_METJA/5-185:Q59055:U67606
LNK  YAAE_BACSU/6-189:P37528:D26185
LNK  YFG0_YEAST/7-217:P43544:D50617
LNK  YMY5_YEAST/18-223:Q03144:Z49807
AMK  xxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YMY5_YEAST/18-223
ASQ  VLALQGAFLEHTNHLKRCLAEN-D.YGIKIEIKTVKTPEDLAQCDALIIPGGESTSMSLIAQRTGLYPCLYEFVHNPEKVVWGTCAGLIFLSAQLENESALVKTLGVLKVDVRRNAFGRQAQSFTQKCDFSNFIPGCDNFPATFIRAPVIERILDPIAVKSLYELP--VNG-KDVVVAATQNHNILVTSFHPELADSDTRFHDWFIRQFVS
DSQ  GTTTTGGCGTTGCAAGGTGCCTTTTTGGAGCATACCAACCATTTAAAAAGGTGTTTGGCTGAAAAC---GAC...TACGGAATAAAGATAGAAATCAAAACTGTAAAAACTCCTGAGGATCTAGCCCAGTGCGACGCCTTAATTATTCCCGGAGGAGAATCTACGTCGATGTCCCTCATCGCTCAAAGAACAGGCTTATATCCTTGTTTATACGAATTTGTTCATAATCCGGAAAAGGTAGTTTGGGGTACTTGTGCTGGTCTCATCTTTTTAAGCGCGCAATTAGAAAACGAAAGTGCCCTAGTAAAGACTTTAGGTGTGTTGAAGGTCGACGTGAGAAGAAACGCATTTGGAAGACAAGCTCAATCTTTTACACAAAAGTGTGATTTTTCCAATTTCATACCTGGCTGTGATAATTTTCCTGCTACATTTATTCGCGCACCCGTGATCGAGAGAATTCTTGATCCTATCGCGGTTAAAAGTTTATATGAATTGCCA------GTGAATGGA---AAGGATGTGGTTGTAGCTGCAACGCAAAATCATAATATCCTTGTGACTTCTTTTCATCCAGAGCTTGCTGACAGTGATACAAGATTTCATGATTGGTTTATCAGACAGTTTGTTTCT
TRN  10010101110011010
NAM  YFG0_YEAST/7-217
ASQ  VLALQGAFIEHVRHVEKCIVENRDfYEKKLSVMTVKDKNQLAQCDALIIPGGESTAMSLIAERTGFYDDLYAFVHNPSKVTWGTCAGLIYISQQLSNEAKLVKTLNLLKVKVKRNAFGRQAQSSTRICDFSNFIPHCNDFPATFIRAPVIEEVLDPEHVQVLYKLDGKDNGGQELIVAAKQKNNILATSFHPELAENDIRFHDWFIREFVL
DSQ  GTCTTGGCATTACAGGGTGCGTTCATTGAACATGTGCGACACGTAGAAAAATGCATCGTCGAAAACAGGGATttcTATGAAAAAAAACTATCTGTGATGACAGTGAAGGATAAAAATCAACTAGCTCAATGTGATGCATTGATCATACCTGGGGGAGAGTCGACTGCAATGTCCCTTATTGCAGAAAGAACAGGATTTTACGACGATCTCTACGCATTCGTACACAACCCAAGCAAGGTAACCTGGGGTACTTGTGCAGGTTTGATTTATATTTCACAACAATTATCTAACGAAGCAAAACTGGTCAAGACGCTGAATTTACTAAAGGTTAAAGTAAAAAGAAATGCATTTGGGAGACAAGCTCAGTCTTCTACCCGGATTTGCGACTTTTCAAACTTTATTCCTCACTGCAATGATTTTCCTGCTACTTTTATAAGAGCCCCAGTAATAGAAGAGGTGCTGGATCCTGAACATGTGCAGGTCCTGTACAAATTAGATGGGAAGGATAATGGTGGTCAAGAACTAATTGTTGCCGCTAAGCAAAAAAACAATATTCTTGCGACATCATTTCATCCGGAATTGGCAGAAAACGATATACGGTTTCACGACTGGTTCATCAGAGAATTTGTTCTT
TRN  10010101100011000
NAM  Y1661_METJA/5-185
ASQ  VLAIQGDVEEHEEAIKKAGYEA--.-------KKVKRVEDLEGIDALIIPGGESTAIGKLMKKYG----LLEKIKNSNLPILGTCAGMVLLSKGTGIN--QIL-LELMDITVKRNAYGRQVDSFEKEIEFKDLG----KVYGVFIRAPVVDKILSDDVEVIARDGD-------KIVGVK-QG-KYMALSFHPELSEDGYKVYKYFVENCVK
DSQ  GTCTTAGCAATTCAGGGAGATGTTGAAGAGCATGAGGAAGCTATTAAAAAAGCTGGTTATGAGGCA------...---------------------AAGAAAGTTAAAAGAGTAGAGGATTTAGAAGGAATTGATGCCTTAATAATTCCAGGAGGGGAGAGCACAGCTATAGGCAAATTAATGAAAAAGTATGGA------------TTATTAGAAAAAATAAAAAATTCTAATTTGCCAATATTGGGAACTTGTGCTGGAATGGTTTTGTTATCAAAAGGGACTGGAATTAAT------CAAATTCTA---CTGGAATTGATGGACATTACAGTTAAAAGAAACGCCTATGGAAGGCAGGTAGATAGCTTTGAAAAAGAAATTGAATTTAAAGATTTAGGA------------AAGGTTTATGGAGTATTTATAAGAGCCCCAGTGGTTGATAAGATTTTAAGTGATGATGTTGAGGTTATAGCAAGAGATGGAGAT---------------------AAAATTGTTGGTGTTAAG---CAAGGA---AAATATATGGCTCTATCATTCCATCCAGAGCTATCTGAAGATGGATATAAGGTTTATAAGTATTTTGTTGAAAACTGTGTTAAA
TRN  10010101100011000
NAM  YAAE_BACSU/6-189
ASQ  VLGLQGAVREHIHAIEACGAAG--.-------LVVKRPEQLNEVDGLILPGGESTTMRRLIDTYQFMEPLREFAAQG-KPMFGTCAGLIILAKEIAGS--DNPHLGLLNVVVERNSFGRQVDSFEADLTIKGLD---EPFTGVFIRAPHILEAG--ENVEVLSEHN----G--RIVAAK-QG-QFLGCSFHPELTED-HRVTQLFVEMVEE
DSQ  GTACTAGGACTTCAAGGAGCAGTTAGAGAGCACATCCATGCGATTGAAGCATGCGGCGCGGCTGGT------...---------------------CTTGTCGTAAAACGTCCGGAGCAGCTGAACGAAGTTGACGGGTTGATTTTGCCGGGCGGTGAGAGCACGACGATGCGCCGTTTGATCGATACGTATCAATTCATGGAGCCGCTTCGTGAATTCGCTGCTCAGGGC---AAACCGATGTTTGGAACATGTGCCGGATTAATTATATTAGCAAAAGAAATTGCCGGTTCA------GATAATCCTCATTTAGGTCTTCTGAATGTGGTTGTAGAACGTAATTCATTTGGCCGGCAGGTTGACAGCTTTGAAGCTGATTTAACAATTAAAGGCTTGGAC---------GAGCCTTTTACTGGGGTATTCATCCGTGCTCCGCATATTTTAGAAGCTGGT------GAAAATGTTGAAGTTCTATCGGAGCATAAT------------GGT------CGTATTGTAGCCGCGAAA---CAGGGG---CAATTCCTTGGCTGCTCATTCCATCCGGAGCTGACAGAAGAT---CACCGAGTGACGCAGCTGTTTGTTGAAATGGTTGAGGAA
TRN  10010101100011000
NAM  Y1648_HAEIN/1-174
ASQ  MLEKLG-----IESVELRNLKN--.-----------FQQHYSDLSGLILPGGESTAIGKLLRELYMLEPIKQAISSG-FPVFGTCAGLILLAKEITSQ--KESHFGTMDIVVERNAYGRQLGSFYTEADCKGVG----KIPMTFIRGPIISSVG--KKVNILATVN------NKIVAAQ-EK-NMLVTSFHPELTNN-LSLHKYFIDICKV
DSQ  ATGCTAGAAAAATTAGGA---------------ATTGAAAGTGTCGAACTGAGAAATTTAAAAAAT------...---------------------------------TTTCAACAACATTACAGTGATTTATCAGGTTTGATTCTACCTGGCGGTGAGTCAACCGCCATAGGAAAACTTTTAAGAGAGCTGTATATGCTGGAACCGATAAAACAAGCTATCTCTTCTGGC---TTTCCTGTCTTTGGAACTTGTGCTGGTTTGATTCTGTTGGCTAAAGAGATTACTTCTCAG------AAAGAGAGTCATTTTGGAACAATGGACATTGTGGTTGAGAGGAATGCCTATGGACGCCAATTGGGAAGTTTCTATACAGAAGCAGATTGCAAAGGGGTTGGT------------AAAATTCCTATGACTTTTATCAGAGGACCTATCATCAGTAGTGTTGGT------AAAAAAGTCAATATTCTTGCAACGGTAAAT------------------AATAAAATCGTTGCAGCCCAA---GAAAAG---AATATGCTGGTAACATCATTTCATCCTGAATTAACAAATAAC---TTGAGTTTGCATAAATACTTTATCGATATATGTAAAGTA
TRN  10010101100011000
//