EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01172 - UPF0023)
FAM  PF01172
PID  UPF0023
DES  Uncharacterized protein family UPF0023
IPR  IPR002140
ANO  3
ALN  248
AID  0.333893
APH  (YL22_YEAST/4-245:0.66476,YOM4_CAEEL/6-247:0.38364,Y592_METJA/1-240:1.31630);
ATP  (YL22_YEAST/4-245,YOM4_CAEEL/6-247,Y592_METJA/1-240);
ATL  2.3647
DNO  2
DLN  744
DID  0.43038
DPH  (YL22_YEAST/4-245:0.34710,Y592_METJA/1-240:0.79882);
DTP  (YL22_YEAST/4-245,Y592_METJA/1-240);
DTL  1.14592
RID  0.281818
RPH  (YL22_YEAST/4-245:1.56257,Y592_METJA/1-240:0.47747);
RTP  (YL22_YEAST/4-245,Y592_METJA/1-240);
RTL  2.04003
LNK  Y592_METJA/1-240:Q58011:U67508
LNK  YL22_YEAST/4-245:Q07953:Z73194
LNK  YOM4_CAEEL/6-247:Q23202:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YL22_YEAST/4-245
ASQ  NQPSGQIKLTNVSLVRLKKARKRFEVACYQNKVQDYRKGIEKDLDEVLQIHQVFMNVSKGLVANKEDLQKCFGTTNVDDVIEEIMHKGEIQLSEKERQLMLNKVNNEMLTIVSAKCINPVSKKRYPPTMIHKALQELKFSPVINKPAKLQALEAIKLLVSKQIIPIVRAKMKVKVAISEPSRQPELIEKISK-LIASSPGESTKPELDPWTCTGLIDPVNYRDLMTLC--DKKGT--VQVLDMA-VID
DSQ  AATCAACCGTCGGGACAGATTAAGTTAACTAATGTTTCATTAGTGAGATTAAAAAAGGCTCGCAAGAGATTTGAAGTCGCGTGCTACCAAAATAAGGTCCAAGACTATCGAAAAGGAATTGAAAAAGATCTGGATGAAGTGCTGCAGATACATCAAGTTTTCATGAATGTTTCGAAAGGCTTGGTTGCTAATAAGGAAGATCTACAAAAGTGTTTCGGGACTACAAATGTTGATGATGTCATCGAGGAGATCATGCATAAGGGAGAGATTCAATTATCGGAAAAAGAAAGACAATTAATGCTTAATAAAGTTAATAACGAAATGCTTACAATAGTTAGCGCTAAATGTATAAATCCTGTGTCAAAGAAAAGATATCCGCCCACAATGATCCACAAAGCTTTACAGGAACTGAAGTTCAGCCCTGTTATTAACAAACCTGCCAAATTGCAAGCTTTAGAGGCTATCAAATTATTGGTTTCTAAGCAAATTATTCCAATAGTAAGGGCGAAGATGAAAGTCAAAGTGGCCATAAGTGAGCCATCTAGACAACCCGAACTTATTGAGAAGATTAGTAAA---TTGATAGCTTCATCGCCTGGAGAGTCAACGAAGCCGGAATTGGATCCTTGGACATGTACAGGTCTTATCGATCCTGTCAATTATAGAGATTTGATGACCCTATGT------GATAAAAAGGGAACT------GTGCAAGTCTTGGATATGGCA---GTCATAGAT
TRN  10010101100011000
NAM  YOM4_CAEEL/6-247
ASQ  KTPTNQKVLTNVAVVRMKKTGKRFEIACYKNKVVNWRNKSEKDIDEVLQTHTVFSNVSKGQLSKKEELIAAFGIEDQLEICKIILDKGDLQVSEKERQAASDQSLKEVSQLIASMVVNPETKRPVPPSVIDKALQEMHFSLKPNRSSKQQALDAIPKL--RETLKIERAKMKIRVAI--PTKEAKSVHTKLKTLFSDV-EVDDWQ-DGSLEMVGLIEPGSFRALDDLVRNETKGHGRLEILSLKDVVE
NAM  Y592_METJA/1-240
ASQ  MGRDIMVSLEEAVIARYTSHGEKFEILVDPYLAAKLKEGQNVDFDELLAIEVVFRDASKGEKAPEELLSKIFGTTDVKEIAKKIILKGQVQLTAKQREEIREQKKRQIITIISRNTINPQTDTPHPPHRIEKAMEELRINIDIYKSAEEQVPEIVKKL--KKVLPIRFEKRDIAVKI--PAEFASKAYNALY-QFGAV-KQEEWQPDGSLIVLIEIPSGIEAEFYAHLNKITKGN--VQTKVVKKYSE
DSQ  GTGGGGAGGGATATTATGGTGTCCTTAGAAGAGGCAGTAATAGCAAGATATACATCCCATGGCGAAAAATTTGAAATTTTAGTTGACCCATATTTAGCGGCTAAGCTTAAAGAAGGGCAAAATGTAGATTTTGATGAGCTTTTAGCTATTGAAGTTGTATTTAGAGATGCAAGTAAAGGGGAGAAAGCCCCTGAAGAGTTACTATCAAAAATATTTGGAACAACAGATGTTAAAGAAATTGCTAAAAAAATTATATTAAAAGGTCAAGTTCAATTAACTGCTAAGCAGAGAGAAGAAATTAGAGAACAAAAAAAGAGGCAAATTATAACCATAATTAGTAGAAACACAATAAACCCTCAAACAGATACTCCACATCCACCGCATAGAATTGAAAAGGCAATGGAAGAGTTAAGAATTAACATAGACATTTATAAAAGTGCTGAAGAACAAGTCCCTGAAATTGTTAAAAAGCTT------AAAAAAGTTCTACCTATTAGATTTGAAAAGAGAGATATCGCTGTTAAAATC------CCAGCAGAATTCGCTTCTAAGGCATATAATGCTTTATAC---CAATTTGGAGCTGTT---AAGCAGGAAGAATGGCAGCCAGATGGTTCTCTAATTGTATTAATTGAAATACCAAGTGGTATTGAAGCGGAGTTTTATGCTCATCTAAATAAAATAACCAAAGGAAAT------GTCCAAACAAAGGTTGTTAAGAAATACAGTGAA
TRN  10010101110011000
//