EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01166 - TSC22)
FAM  PF01166
PID  TSC22
DES  TSC-22/dip/bun family
IPR  IPR000580
ANO  4
ALN  60
AID  0.569185
APH  (YAE7_CAEEL/43-102:0.71448,(GILZ_HUMAN/58-117:0.25447,TS22_CHICK/59-118:0.00000):0.27143,BUN1_DROME/64-123:0.25891);
ATP  (YAE7_CAEEL/43-102,(GILZ_HUMAN/58-117,TS22_CHICK/59-118),BUN1_DROME/64-123);
ATL  1.49929
DNO  4
DLN  180
DID  0.573148
DPH  (YAE7_CAEEL/43-102:0.64148,(GILZ_HUMAN/58-117:0.19325,TS22_CHICK/59-118:0.11493):0.19603,BUN1_DROME/64-123:0.19207);
DTP  (YAE7_CAEEL/43-102,(GILZ_HUMAN/58-117,TS22_CHICK/59-118),BUN1_DROME/64-123);
DTL  1.33776
RID  0.569185
RPH  (YAE7_CAEEL/43-102:0.71448,(GILZ_HUMAN/58-117:0.25447,TS22_CHICK/59-118:0.00000):0.27143,BUN1_DROME/64-123:0.25891);
RTP  (YAE7_CAEEL/43-102,(GILZ_HUMAN/58-117,TS22_CHICK/59-118),BUN1_DROME/64-123);
RTL  1.49929
LNK  BUN1_DROME/64-123:Q24522:L42511
LNK  GILZ_HUMAN/58-117:Q99576:AF183393
LNK  TS22_CHICK/59-118:Q91012:D49740
LNK  YAE7_CAEEL/43-102:Q22544:Z68119
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YAE7_CAEEL/43-102
ASQ  MDLVKTHLTFAVREEVETLRTTITDLEARLNALREENRLLRENVSPEVLAFITANKQLCE
DSQ  ATGGATTTGGTAAAAACACATCTCACGTTTGCGGTACGGGAGGAGGTCGAGACTTTGCGGACGACAATAACCGATTTGGAAGCTAGGCTCAATGCACTGCGAGAGGAAAACCGTTTACTTCGTGAAAACGTGTCTCCAGAAGTGTTGGCTTTCATCACTGCAAACAAGCAACTTTGCGAA
TRN  10010101100011010
NAM  TS22_CHICK/59-118
ASQ  MDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENTLLKTLASPEQLAQFQAQLQTGS
DSQ  ATGGACCTGGTGAAGAGCCACCTGATGTACGCCGTGCGGGAGGAGGTGGAGGTCCTGAAGGAGCAGATCAAGGAGCTGATAGAGAAGAACTCGCAGCTGGAGCAGGAAAACACGCTGCTCAAAACGCTCGCCAGCCCGGAGCAGCTCGCCCAGTTCCAGGCGCAGCTGCAGACTGGTTCC
TRN  10010101100011011
NAM  GILZ_HUMAN/58-117
ASQ  MDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEE
DSQ  ATGGATCTGGTGAAGAATCATCTGATGTATGCTGTGAGAGAGGAGGTGGAGATCCTGAAGGAGCAGATCCGAGAGCTGGTGGAGAAGAACTCCCAGCTAGAGCGTGAGAACACCCTGTTGAAGACCCTGGCAAGCCCAGAGCAGCTGGAGAAGTTCCAGTCCTGTCTGAGCCCTGAAGAG
TRN  10010101100011011
NAM  BUN1_DROME/64-123
ASQ  MDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAA
DSQ  ATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGCAGCTGCAGTTGCAGCTACAACTCGCCGCA
TRN  10010101100011011
//