EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01157 - Ribosomal_L21e)
FAM  PF01157
PID  Ribosomal_L21e
DES  Ribosomal protein L21e
IPR  IPR001147
ANO  6
ALN  99
AID  0.414014
APH  (RL21_HUMAN/1-99:0.18215,RL21_CAEEL/1-99:0.23274,((RL21_ENTHI/2-100:0.24032,(RL21_HALMA/1-95:0.87173,RL21_METJA/3-97:0.07351):1.22370):0.38736,RL21A_YEAST/2-100:0.23448):0.12383);
ATP  (RL21_HUMAN/1-99,RL21_CAEEL/1-99,((RL21_ENTHI/2-100,(RL21_HALMA/1-95,RL21_METJA/3-97)),RL21A_YEAST/2-100));
ATL  3.56982
DNO  5
DLN  297
DID  0.465795
DPH  (((RL21_HUMAN/1-99:0.23959,RL21A_YEAST/2-100:0.28452):0.24038,RL21_ENTHI/2-100:0.24464):0.45230,RL21_HALMA/1-95:0.60233,RL21_METJA/3-97:0.28574);
DTP  (((RL21_HUMAN/1-99,RL21A_YEAST/2-100),RL21_ENTHI/2-100),RL21_HALMA/1-95,RL21_METJA/3-97);
DTL  2.3495
RID  0.385623
RPH  ((RL21_HALMA/1-95:0.85975,RL21_METJA/3-97:0.08218):1.22645,(RL21A_YEAST/2-100:0.24388,RL21_HUMAN/1-99:0.26415):0.41759,RL21_ENTHI/2-100:0.21475);
RTP  ((RL21_HALMA/1-95,RL21_METJA/3-97),(RL21A_YEAST/2-100,RL21_HUMAN/1-99),RL21_ENTHI/2-100);
RTL  3.30875
LNK  RL21A_YEAST/2-100:Q02753:U02073
LNK  RL21_CAEEL/1-99:P34334:
LNK  RL21_ENTHI/2-100:P38653:X73634
LNK  RL21_HALMA/1-95:P12734:AY596297
LNK  RL21_HUMAN/1-99:P46778:X89401
LNK  RL21_METJA/3-97:P54013:U67462
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RL21_METJA/3-97
ASQ  QMSEGFRRKTRKKLSKHPRERGLYPITRALREFKEGEYVHIVIDPSVHKGMPHPRFHGRTGIVV----GKQGRAFIVKVRDGGKYKQIIAYPQHLRPAT
DSQ  CAAATGAGTGAAGGATTTAGAAGAAAAACAAGAAAGAAGTTATCAAAACACCCAAGAGAAAGAGGTCTCTATCCAATAACAAGAGCTTTGAGAGAGTTTAAAGAAGGAGAGTATGTCCATATAGTTATAGATCCATCAGTCCATAAGGGAATGCCACACCCAAGATTTCATGGAAGAACAGGGATTGTTGTT------------GGTAAGCAGGGAAGAGCATTTATTGTTAAAGTAAGAGATGGAGGAAAATACAAACAAATCATTGCTTACCCACAGCATTTAAGACCTGCTACT
TRN  10010101110011000
NAM  RL21_HALMA/1-95
ASQ  PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVE----GKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
DSQ  CCTAGTTCAAACGGACCTCTCGAAGGAACACGAGGCAAGCTCAAGAACAAGCCCCGCGACCGCGGCACCTCGCCGCCCCAGCGCGCCGTCGAAGAGTTCGACGACGGCGAGAAAGTCCACCTCAAGATTGACCCGTCCGTGCCGAACGGGCGCTTCCACCCGCGGTTTGACGGCCAGACCGGAACCGTCGAG------------GGGAAGCAGGGTGACGCGTACAAGGTCGATATCGTTGACGGTGGCAAAGAGAAGACCATCATCGTCACCGCTGCGCACCTGCGCCGGCAAGAA
TRN  11011101101011001
NAM  RL21_HUMAN/1-99
ASQ  TNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSK
DSQ  ACGAACACAAAGGGAAAGAGGAGAGGCACCCGATATATGTTCTCTAGGCCTTTTAGAAAACATGGAGTTGTTCCTTTGGCCACATATATGCGAATCTATAAGAAAGGTGATATTGTAGACATCAAGGGAATGGGTACTGTTCAAAAAGGAATGCCCCACAAGTGTTACCATGGCAAAACTGGAAGAGTCTACAATGTTACCCAGCATGCTGTTGGCATTGTTGTAAACAAACAAGTTAAGGGCAAGATTCTTGCCAAGAGAATTAATGTGCGTATTGAGCACATTAAGCACTCTAAG
TRN  10010101110011011
NAM  RL21_CAEEL/1-99
ASQ  TNSKGLRRGTRYMFARDFRKHGVEHLSTYYTQYKRGDLVDIKTNGAFQKGMPFKAYHGRTGRIFNVTRGAVGIIVNKRVRGNILPKRINIRIEHIKPSK
NAM  RL21A_YEAST/2-100
ASQ  GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSK
DSQ  GGTAAATCACACGGTTACAGATCTCGTACTCGTTACATGTTCCAACGTGACTTCAGAAAGCATGGTGCCGTCCATCTTTCTACTTACTTGAAGGTCTACAAGGTTGGTGACATTGTCGACATCAAAGCCAATGGTTCTATCCAAAAGGGTATGCCACACAAGTTTTACCAAGGTAAGACCGGTGTTGTCTACAACGTTACTAAGTCTTCTGTTGGTGTTATCATCAACAAGATGGTCGGTAACAGATATCTAGAAAAAAGATTAAACTTAAGAGTTGAACACATCAAGCACTCCAAG
TRN  10010101110011000
NAM  RL21_ENTHI/2-100
ASQ  PLSNGRNRRTRKLFKRPFRGHGLSNTSTILHTYKVGDYVTILCNSSIQHGLPYKAFHGKTGRVWNVNPHAIGVMVNKKVNNRIVVKRLHISPEHIRPSG
DSQ  CCATTATCTAACGGTAGAAATAGAAGAACCAGAAAATTATTTAAGAGACCATTCAGAGGACATGGACTCTCAAACACTTCAACCATTCTTCACACATATAAAGTTGGTGATTATGTAACAATCCTCTGTAATTCATCTATTCAACATGGTCTTCCATACAAAGCTTTCCATGGAAAGACTGGACGTGTTTGGAATGTTAATCCACATGCCATTGGAGTTATGGTAAATAAGAAAGTCAATAATAGAATTGTAGTTAAAAGACTTCACATTAGCCCAGAACATATCAGACCATCTGGA
TRN  10010101110011000
//