EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01099 - Uteroglobin)
FAM  PF01099
PID  Uteroglobin
DES  Uteroglobin family
IPR  IPR006038
ANO  6
ALN  94
AID  0.345298
APH  (UTER_LEPCA/1-90:0.18430,(UTER_MOUSE/1-90:0.40366,UTER_HUMAN/1-90:0.20786):0.10510,((MGBA_HUMAN/1-90:0.46618,PSC3_RAT/1-91:0.52827):0.75840,FELA_FELCA/1-92:1.06237):0.44318);
ATP  (UTER_LEPCA/1-90,(UTER_MOUSE/1-90,UTER_HUMAN/1-90),((MGBA_HUMAN/1-90,PSC3_RAT/1-91),FELA_FELCA/1-92));
ATL  4.15932
DNO  5
DLN  282
DID  0.531768
DPH  (UTER_LEPCA/1-90:0.08303,(UTER_MOUSE/1-90:0.24111,UTER_HUMAN/1-90:0.12805):0.07743,(MGBA_HUMAN/1-90:0.33523,PSC3_RAT/1-91:0.35077):0.63242);
DTP  (UTER_LEPCA/1-90,(UTER_MOUSE/1-90,UTER_HUMAN/1-90),(MGBA_HUMAN/1-90,PSC3_RAT/1-91));
DTL  1.84804
RID  0.386267
RPH  ((UTER_LEPCA/1-90:0.16308,(UTER_MOUSE/1-90:0.40094,UTER_HUMAN/1-90:0.22250):0.12105):1.17694,MGBA_HUMAN/1-90:0.45305,PSC3_RAT/1-91:0.53788);
RTP  ((UTER_LEPCA/1-90,(UTER_MOUSE/1-90,UTER_HUMAN/1-90)),MGBA_HUMAN/1-90,PSC3_RAT/1-91);
RTL  3.07544
LNK  FELA_FELCA/1-92:P30438:
LNK  MGBA_HUMAN/1-90:Q13296:U33147
LNK  PSC3_RAT/1-91:P02780:V01263
LNK  UTER_HUMAN/1-90:P11684:X13197
LNK  UTER_LEPCA/1-90:P06913:M25609
LNK  UTER_MOUSE/1-90:Q06318:L04503
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  UTER_LEPCA/1-90
ASQ  MKLTITLALVTLALLCSPASAG-ICPGFAHVIENLLLG--TPSSYETSLKEFQPDDAMKDAGMQMKKVLDT-LPQTTRENIIKLTEKIVKSPLC
DSQ  ATGAAGCTCACCATCACCCTCGCCCTGGTCACCCTGGCTCTCCTCTGCAGCCCTGCATCTGCGGGC---ATCTGCCCGGGATTTGCCCACGTCATTGAAAACCTCCTCCTGGGC------ACGCCCTCCAGTTACGAGACATCCCTGAAGGAATTCCAACCTGACGACGCCATGAAAGACGCAGGGATGCAGATGAAGAAGGTGTTGGACACC---CTGCCCCAGACGACCAGAGAGAACATCATAAAGCTCACGGAAAAAATAGTCAAGAGCCCACTGTGT
TRN  10010101100011011
NAM  UTER_HUMAN/1-90
ASQ  MKLAVTLTLVTLALCCSSASAE-ICPSFQRVIETLLMD--TPSSYEAAMELFSPDQDMREAGAQLKKLVDT-LPQKPRESIIKLMEKIAQSSLC
DSQ  ATGAAACTCGCTGTCACCCTCACCCTGGTCACACTGGCTCTCTGCTGCAGCTCCGCTTCTGCAGAG---ATCTGCCCGAGCTTTCAGCGTGTCATCGAAACCCTCCTCATGGAC------ACACCCTCCAGTTATGAGGCTGCCATGGAACTTTTCAGCCCTGATCAAGACATGAGGGAGGCAGGGGCTCAGCTGAAGAAGCTGGTGGACACC---CTCCCCCAAAAGCCCAGAGAAAGCATCATTAAGCTCATGGAAAAAATAGCCCAAAGCTCACTGTGT
TRN  10010101100011001
NAM  UTER_MOUSE/1-90
ASQ  MKIAITITVVMLSICCSSASSD-ICPGFLQVLEALLME--SESGYVASLKPFNPGSDLQNAGTQLKRLVDT-LPQETRINIMKLTEKILTSPLC
DSQ  ATGAAGATCGCCATCACAATCACTGTGGTCATGCTGTCCATCTGCTGCAGCTCAGCTTCTTCGGAC---ATCTGCCCAGGATTTCTTCAAGTCCTTGAGGCCCTCCTCATGGAA------TCAGAGTCTGGTTATGTGGCATCCCTGAAGCCTTTCAACCCTGGCTCAGACCTGCAAAATGCGGGCACCCAGCTGAAGAGACTGGTGGATACC---CTCCCACAAGAGACCAGGATAAACATCATGAAGCTCACGGAGAAAATCCTAACAAGTCCTCTGTGT
TRN  10010101100011001
NAM  FELA_FELCA/1-92
ASQ  MKGACVLVLLWAALLLISGGNCEICPAVKRDVDLFLTG--TPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
NAM  PSC3_RAT/1-91
ASQ  MKLVFLFLLVTIPICCYASGSG--CSILDEVIRGTINSTVTLHDYMKLVKPYVQDHFTEKAVKQFKQCFLD-QTDKTLENVGVMMEAIFNSESC
DSQ  ATGAAGCTGGTGTTTCTATTCTTGTTGGTCACCATCCCTATTTGCTGCTATGCCAGTGGTTCTGGC------TGCAGTATTCTAGATGAAGTTATTAGAGGTACAATTAACTCAACTGTGACTTTACATGACTATATGAAATTAGTTAAGCCATATGTACAAGATCATTTTACTGAAAAGGCTGTGAAGCAATTCAAGCAGTGTTTTCTAGAT---CAGACCGACAAGACTCTGGAAAATGTTGGCGTGATGATGGAGGCAATATTTAACAGTGAAAGCTGT
TRN  10010101100011000
NAM  MGBA_HUMAN/1-90
ASQ  MKLLMVLMLAALSQHCYAGSG---CPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLN-QTDETLSNVEVFMQLIYDSSLC
DSQ  ATGAAGTTGCTGATGGTCCTCATGCTGGCGGCCCTCTCCCAGCACTGCTACGCAGGCTCTGGC---------TGCCCCTTATTGGAGAATGTGATTTCCAAGACAATCAATCCACAAGTGTCTAAGACTGAATACAAAGAACTTCTTCAAGAGTTCATAGACGACAATGCCACTACAAATGCCATAGATGAATTGAAGGAATGTTTTCTTAAC---CAAACGGATGAAACTCTGAGCAATGTTGAGGTGTTTATGCAATTAATATATGACAGCAGTCTTTGT
TRN  10010101100011010
//