EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01085 - HH_signal)
FAM  PF01085
PID  HH_signal
DES  Hedgehog amino-terminal signaling domain
IPR  IPR000320
ANO  4
ALN  163
AID  0.714408
APH  ((O17499_BRAFL/28-188:0.15496,HH_DROME/35-194:0.34321):0.02972,DHH1_XENLA/23-184:0.15817,IHH_BRARE/24-184:0.11574);
ATP  ((O17499_BRAFL/28-188,HH_DROME/35-194),DHH1_XENLA/23-184,IHH_BRARE/24-184);
ATL  0.8018
DNO  3
DLN  489
DID  0.679124
DPH  (IHH_BRARE/24-184:0.15607,DHH1_XENLA/23-184:0.23660,O17499_BRAFL/28-188:0.26462);
DTP  (IHH_BRARE/24-184,DHH1_XENLA/23-184,O17499_BRAFL/28-188);
DTL  0.65729
RID  0.77461
RPH  (IHH_BRARE/24-184:0.09911,DHH1_XENLA/23-184:0.17245,O17499_BRAFL/28-188:0.18717);
RTP  (IHH_BRARE/24-184,DHH1_XENLA/23-184,O17499_BRAFL/28-188);
RTL  0.45873
LNK  DHH1_XENLA/23-184:Q91610:U26349
LNK  HH_DROME/35-194:Q02936:
LNK  IHH_BRARE/24-184:Q98862:Y08426
LNK  O17499_BRAFL/28-188:O17499:Y13858
AMK  xxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IHH_BRARE/24-184
ASQ  CGPGR..GYGKRRTPRKLTPLAYKQFSPNVAEKTLGASGRYEGKVTPSSERFKELTPNYNPDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNLWPGVRLRVTEGWDEDGLHSEESLHYEGRAVDITTSDRDRNKYRMLARLAVEAGFDWVYYESKGHVHCS
DSQ  TGTGGACCGGGCAGA......GGTTACGGCAAGAGACGGACTCCGCGGAAACTCACGCCTCTCGCCTATAAGCAGTTCAGTCCGAACGTAGCCGAGAAAACGCTGGGGGCGAGCGGGAGATATGAGGGGAAGGTCACCCCCAGCTCCGAGCGCTTTAAAGAGCTGACCCCAAACTACAACCCGGACATCATCTTCAAGGATGAGGAGAACACAGGTGCGGACCGCATGATGACGCAGCGCTGCAAGGATAAGCTGAACTCTCTGGCCATCTCGGTGATGAACCTGTGGCCCGGTGTGCGTCTGCGTGTGACGGAGGGCTGGGATGAGGACGGACTACACTCTGAAGAATCTCTGCATTATGAGGGCAGAGCGGTGGACATTACTACCTCGGACCGCGATCGCAACAAGTACCGCATGCTGGCTCGTCTTGCGGTGGAAGCAGGCTTCGACTGGGTCTATTACGAATCCAAAGGCCACGTACACTGCAGT
TRN  10010101100011011
NAM  DHH1_XENLA/23-184
ASQ  CGPGRgpVGRRRY-MRKLVPLHYKQFVPNVPEKTLGASGKSEGKIHRGSERFIELVPNYNPDIIFKDEEKTGADRLMTERCKDRVNALAISVMNMWPGVKLRVTEGWDEDGHHAHDSLHYEGRALDITTSDRDRNKYGMLARLAVEAGFDWVYYESKAHIHVS
DSQ  TGTGGTCCTGGCCGGgggcctGTTGGCCGTCGCCGTTAC---ATGAGGAAACTAGTCCCACTGCACTACAAGCAGTTTGTGCCTAATGTGCCAGAGAAGACTCTAGGGGCCAGTGGCAAGTCAGAGGGCAAGATTCACCGGGGCTCAGAAAGGTTCATCGAGTTGGTCCCCAACTACAACCCAGACATCATCTTCAAGGATGAAGAAAAAACAGGAGCTGACAGGCTCATGACTGAGCGCTGTAAAGACAGAGTCAATGCGTTGGCTATCTCTGTGATGAACATGTGGCCAGGTGTGAAGCTACGGGTTACCGAGGGTTGGGACGAGGATGGACACCACGCTCACGACTCTCTGCATTATGAAGGGCGCGCACTGGACATTACAACATCTGACCGAGACAGGAACAAATACGGCATGTTGGCACGTCTGGCAGTGGAAGCTGGCTTTGACTGGGTGTATTATGAATCCAAAGCACACATCCATGTCTCT
TRN  10010101100011001
NAM  O17499_BRAFL/28-188
ASQ  CGPGG..RFGRRRHPRKLTPFVYKQQMPAVSENTFGASGLFNGRITRDSERFHTLKQNFNTDIIFKDEEKTGADRFMTQRCKDKLNALAISVMNQWEGVKLRVTEGWDEDGFHTEESLHYEGRAVDITTSDRDRTKYGMLARLAVEAGFDWVYYESKAHIHCS
DSQ  TGCGGGCCCGGGGGA......AGGTTCGGCCGGCGACGGCACCCTCGCAAGCTCACCCCCTTCGTGTACAAGCAACAGATGCCGGCGGTCTCCGAGAACACCTTTGGGGCCTCTGGCCTGTTCAACGGACGGATTACTCGCGACTCCGAGCGTTTCCATACTCTGAAACAAAATTTCAACACAGACATAATCTTCAAGGATGAGGAAAAAACGGGGGCTGACCGATTCATGACACAGAGATGTAAGGACAAGCTAAACGCGCTGGCCATTTCCGTGATGAATCAGTGGGAGGGGGTAAAACTAAGAGTGACGGAGGGCTGGGACGAGGACGGCTTTCACACCGAGGAGTCGCTGCACTACGAGGGCAGGGCGGTGGACATCACCACAAGCGACAGGGACAGAACGAAATACGGCATGCTGGCCAGGCTAGCGGTGGAGGCGGGGTTCGACTGGGTGTACTACGAGTCTAAGGCGCACATACACTGTTCC
TRN  10010101100011011
NAM  HH_DROME/35-194
ASQ  CGPGR..GLGRHR-ARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCS
//