EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01081 - Aldolase)
FAM  PF01081
PID  Aldolase
DES  KDPG and KHG aldolase
IPR  IPR000887
ANO  5
ALN  196
AID  0.388411
APH  (((ALKH_ECOLI/8-203:0.25125,ALKH_ZYMMO/1-192:0.48681):0.17398,ALKD_PSEPU/19-214:0.48541):0.16347,ALKH_BACSU/6-196:0.94517,ALKH_HAEIN/8-203:0.64671);
ATP  (((ALKH_ECOLI/8-203,ALKH_ZYMMO/1-192),ALKD_PSEPU/19-214),ALKH_BACSU/6-196,ALKH_HAEIN/8-203);
ATL  3.15279
DNO  5
DLN  588
DID  0.470966
DPH  ((ALKH_ECOLI/8-203:0.24367,ALKH_ZYMMO/1-192:0.33163):0.12939,(ALKH_HAEIN/8-203:0.48069,ALKH_BACSU/6-196:0.57618):0.23348,ALKD_PSEPU/19-214:0.37080);
DTP  ((ALKH_ECOLI/8-203,ALKH_ZYMMO/1-192),(ALKH_HAEIN/8-203,ALKH_BACSU/6-196),ALKD_PSEPU/19-214);
DTL  2.36584
RID  0.388411
RPH  (((ALKH_ECOLI/8-203:0.25125,ALKH_ZYMMO/1-192:0.48681):0.17398,ALKD_PSEPU/19-214:0.48541):0.16347,ALKH_BACSU/6-196:0.94517,ALKH_HAEIN/8-203:0.64671);
RTP  (((ALKH_ECOLI/8-203,ALKH_ZYMMO/1-192),ALKD_PSEPU/19-214),ALKH_BACSU/6-196,ALKH_HAEIN/8-203);
RTL  3.15279
LNK  ALKD_PSEPU/19-214:P00885:AJ279003
LNK  ALKH_BACSU/6-196:P50846:L47838
LNK  ALKH_ECOLI/8-203:P10177:X68871
LNK  ALKH_HAEIN/8-203:P44480:U32690
LNK  ALKH_ZYMMO/1-192:Q00384:X58364
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ALKH_ZYMMO/1-192
ASQ  MDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIK-IMKEVPGAVVGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLGLDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPTSAPKYLENPSILCVGGSWVVPAG---KPDVAKITAL
DSQ  ATCGATTCCGTAATGCGTTTGGCACCGGTTATGCCGGTCCTCGTCATTGAAGATATTGCTGATGCAAAACCTATCGCAGAAGCTTTGGTTGCTGGTGGTCTGAACGTTCTTGAAGTAACGCTTCGCACCCCTTGTGCTCTTGAAGCCATCAAG---ATCATGAAAGAAGTTCCGGGTGCCGTTGTTGGTGCCGGTACGGTTCTGAACGCAAAAATGCTCGACCAAGCTCAGGAAGCTGGTTGCGAATTTTTCGTTAGCCCGGGTCTGACCGCTGACCTCGGCAAGCATGCTGTTGCCCAGAAAGCTGCTTTGCTTCCGGGTGTTGCTAATGCTGCTGATGTGATGCTTGGTCTTGACCTTGGTCTTGATCGCTTCAAATTCTTCCCGGCTGAAAATATCGGTGGTTTACCTGCCCTGAAGTCCATGGCTTCTGTTTTCCGTCAGGTTCGTTTCTGCCCGACCGGTGGTATCACCCCGACGTCAGCTCCTAAATATCTTGAAAACCCGTCCATTCTTTGCGTCGGTGGTAGCTGGGTTGTTCCGGCTGGC---------AAACCAGATGTCGCAAAAATCACGGCACTC
TRN  11011101101011000
NAM  ALKH_ECOLI/8-203
ASQ  AESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRITKL
DSQ  GCGGAATCAATCCTGACCACCGGCCCGGTTGTACCGGTTATCGTGGTAAAAAAACTGGAACACGCGGTGCCGATGGCAAAAGCGTTGGTTGCTGGTGGGGTGCGCGTTCTGGAAGTGACTCTGCGTACCGAGTGTGCAGTTGACGCTATCCGTGCTATCGCCAAAGAAGTGCCTGAAGCGATTGTGGGTGCCGGTACGGTGCTGAATCCACAGCAGCTGGCAGAAGTCACTGAAGCGGGTGCACAGTTCGCAATTAGCCCGGGTCTGACCGAGCCGCTGCTGAAAGCTGCTACCGAAGGGACTATTCCTCTGATTCCGGGGATCAGCACTGTTTCCGAACTGATGCTGGGTATGGACTACGGTTTGAAAGAGTTCAAATTCTTCCCGGCTGAAGCTAACGGCGGCGTGAAAGCCCTGCAGGCGATCGCGGGTCCGTTCTCCCAGGTCCGTTTCTGCCCGACGGGTGGTATTTCTCCGGCTAACTACCGTGACTACCTGGCGCTGAAAAGCGTGCTGTGCATCGGTGGTTCCTGGCTGGTTCCGGCAGATGCGCTGGAAGCGGGCGATTACGACCGCATTACTAAGCTG
TRN  11011101101011001
NAM  ALKD_PSEPU/19-214
ASQ  IDAICEKARILPVITIAREEDILPLADALAAGGIRTLEVTLRSQHGLKAIQVLREQRPELCVGAGTVLDRSMFAAVEAAGAQFVVTPGITEDILEAGVDSEIPLLPGISTPSEIMMGYALGYRRFKLFPAEISGGVAAIKAFGGPFGDIRFCPTGGVNPANVRNYMALPNVMCVGTGWMLDSSWIKNGDWARIEAC
DSQ  ATCGATGCCATCTGCGAAAAGGCGCGCATCCTGCCGGTCATTACCATCGCCCGTGAGGAAGACATCCTGCCGCTGGCCGATGCCCTGGCCGCCGGCGGTATCCGTACCCTGGAAGTGACCCTGCGTTCCCAGCATGGGCTCAAGGCCATCCAGGTGCTGCGTGAGCAGCGCCCGGAGTTGTGCGTTGGGGCAGGCACCGTACTGGATCGCAGCATGTTCGCCGCTGTCGAGGCTGCGGGCGCGCAGTTCGTCGTCACCCCGGGCATTACCCAGGACATTCTCGAAGCGGGCGTGGACAGCGAAATCCCGCTGCTGCCAGGCATCAGTACGCCCTCTGAAATCATGATGGGCTATGCCCTGGGCTACCGCAGGTTCAAGTTGTTCCCGGCGGAAATCAGCGGCGGCGTGGCGGCGATCAAGGCCTTTGGCGGCCCGTTCGGCGATATTCGCTTTTGCCCAACCGGCGGCGTTAACCCGGCCAATGTACGTAACTACATGGCATTGCCCAACGTGATGTGCGTGGGCGGAACCTGGATGCTCGACAGCAGCTGGATCAAGAACGGCGACTGGGCGCGGATCGAAGCGTGC
TRN  10010101100011011
NAM  ALKH_HAEIN/8-203
ASQ  IIEKLRELKIVPVIALDNADDILPLADTLAKNGLSVAEITFRSEAAADAIRLLRANRPDFLIAAGTVLTAEQVVLAKSSGADFVVTPGLNPKIVKLCQDLNFPITPGVNNPMAIEIALEMGISAVKFFPAEASGGVKMIKALLGPYAQLQIMPTGGIGLHNIRDYLAIPNIVACGGSWFVEKKLIQSNNWDEIGRL
DSQ  ATTATTGAAAAACTTCGTGAACTCAAAATTGTGCCTGTAATTGCGTTGGATAATGCAGACGATATTTTGCCGCTAGCAGATACGTTGGCTAAAAATGGTTTATCTGTGGCAGAGATTACTTTTCGCTCTGAAGCAGCGGCAGATGCGATCCGTTTGTTGCGTGCAAATAGACCTGACTTTTTAATTGCTGCGGGCACAGTTTTAACTGCGGAACAAGTAGTTTTAGCTAAAAGTAGCGGAGCAGATTTTGTGGTTACTCCTGGGTTAAATCCAAAAATTGTGAAATTATGTCAAGATTTGAATTTTCCAATAACACCAGGGGTGAATAATCCTATGGCAATTGAAATTGCATTAGAAATGGGAATTTCGGCGGTAAAATTTTTCCCTGCAGAGGCTTCAGGCGGAGTGAAAATGATTAAAGCATTGCTTGGTCCTTATGCTCAATTACAGATAATGCCGACTGGTGGTATAGGGCTTCATAACATAAGGGATTATCTTGCTATTCCTAATATTGTTGCTTGTGGAGGCTCTTGGTTTGTGGAGAAAAAATTGATTCAATCCAATAATTGGGATGAAATTGGACGATTA
TRN  10010101110011000
NAM  ALKH_BACSU/6-196
ASQ  VENRLKEAKLIAVIRSKDKQEACQQIESLLDKGIRAVEVTYTTPGASDIIE-SFRNREDILIGAGTVISAQQAGEAAKAGAQFIVSPGFSADLAEHLSFVKTHYIPGVLTPSEIMEALTFGFTTLKLFPSGVFG-IPFMKNLAGPFPQVTFIPTGGIHPSEVPDWLRAGAGAVGVGSQLGSCS---KEDLQAVFQV
DSQ  GTTGAAAACCGTCTGAAAGAAGCAAAGCTGATTGCAGTCATTCGTTCAAAGGATAAGCAGGAGGCCTGTCAGCAGATTGAGAGTTTATTAGATAAAGGGATTCGTGCAGTTGAAGTGACGTATACGACCCCCGGGGCATCAGATATTATCGAA---TCCTTCCGTAATAGGGAAGATATTTTAATTGGCGCGGGTACGGTCATCAGCGCGCAGCAAGCTGGGGAAGCTGCTAAGGCTGGCGCGCAGTTTATTGTCAGTCCGGGTTTTTCAGCTGATCTTGCTGAACATCTATCTTTTGTAAAGACACATTATATCCCCGGCGTCTTGACTCCGAGCGAAATTATGGAAGCGCTGACATTCGGTTTTACGACATTAAAGCTGTTCCCAAGCGGTGTGTTTGGC---ATTCCGTTTATGAAAAATTTAGCGGGTCCTTTCCCGCAGGTGACCTTTATTCCGACAGGCGGGATACATCCGTCTGAAGTGCCTGATTGGCTTAGAGCCGGAGCTGGCGCCGTCGGAGTCGGCAGCCAGTTGGGCAGCTGTTCA---------AAAGAGGATTTGCAGGCTGTTTTCCAAGTG
TRN  10010101100011000
//