EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01024 - Colicin)
FAM  PF01024
PID  Colicin
DES  Colicin pore forming domain
IPR  IPR000293
ANO  9
ALN  203
AID  0.355484
APH  (CEAN_ECOLI/185-382:0.27696,((CEAB_ECOLI/310-508:0.16276,O24681_SHIBO/416-614:0.14614):0.19742,CEA_CITFR/389-587:0.19484):0.14497,(((CEA1_ECOLI/334-520:0.28045,CEAK_ECOLI/360-546:0.19651):0.40606,(CEIA_ECOLI/438-624:0.54035,CEIB_ECOLI/438-624:0.37109):0.22707):0.31435,Q06308_SERMA/258-446:0.86693):0.66770);
ATP  (CEAN_ECOLI/185-382,((CEAB_ECOLI/310-508,O24681_SHIBO/416-614),CEA_CITFR/389-587),(((CEA1_ECOLI/334-520,CEAK_ECOLI/360-546),(CEIA_ECOLI/438-624,CEIB_ECOLI/438-624)),Q06308_SERMA/258-446));
ATL  4.9936
DNO  9
DLN  609
DID  0.490737
DPH  (CEAN_ECOLI/185-382:0.30419,((CEAB_ECOLI/310-508:0.17836,O24681_SHIBO/416-614:0.14790):0.12439,CEA_CITFR/389-587:0.18571):0.06619,(((CEA1_ECOLI/334-520:0.23684,CEAK_ECOLI/360-546:0.20655):0.32882,(CEIA_ECOLI/438-624:0.43448,CEIB_ECOLI/438-624:0.22642):0.09755):0.12465,Q06308_SERMA/258-446:0.67628):0.30041);
DTP  (CEAN_ECOLI/185-382,((CEAB_ECOLI/310-508,O24681_SHIBO/416-614),CEA_CITFR/389-587),(((CEA1_ECOLI/334-520,CEAK_ECOLI/360-546),(CEIA_ECOLI/438-624,CEIB_ECOLI/438-624)),Q06308_SERMA/258-446));
DTL  3.63874
RID  0.355484
RPH  (CEAN_ECOLI/185-382:0.27696,((CEAB_ECOLI/310-508:0.16276,O24681_SHIBO/416-614:0.14614):0.19742,CEA_CITFR/389-587:0.19484):0.14497,(((CEA1_ECOLI/334-520:0.28045,CEAK_ECOLI/360-546:0.19651):0.40606,(CEIA_ECOLI/438-624:0.54035,CEIB_ECOLI/438-624:0.37109):0.22707):0.31435,Q06308_SERMA/258-446:0.86693):0.66770);
RTP  (CEAN_ECOLI/185-382,((CEAB_ECOLI/310-508,O24681_SHIBO/416-614),CEA_CITFR/389-587),(((CEA1_ECOLI/334-520,CEAK_ECOLI/360-546),(CEIA_ECOLI/438-624,CEIB_ECOLI/438-624)),Q06308_SERMA/258-446));
RTL  4.9936
LNK  CEA1_ECOLI/334-520:P02978:J01563
LNK  CEAB_ECOLI/310-508:P05819:M16816
LNK  CEA_CITFR/389-587:P04480:X01008
LNK  CEAK_ECOLI/360-546:Q47502:X87834
LNK  CEAN_ECOLI/185-382:P08083:Y00533
LNK  CEIA_ECOLI/438-624:P06716:M13819
LNK  CEIB_ECOLI/438-624:P04479:X01009
LNK  O24681_SHIBO/416-614:O24681:Y11823
LNK  Q06308_SERMA/258-446:Q06308:X62454
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  CEAN_ECOLI/185-382
ASQ  KEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVV----AGVAISLFGAVL-SFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNII
DSQ  AAGGAAGAAAAAGAAAAAAATGAAAAAGAAGCCTTGCTAAAGGCTAGTGAACTTGTGTCTGGTATGGGGGATAAGCTTGGCGAGTATCTTGGAGTAAAATATAAAAATGTAGCTAAGGAAGTTGCCAATGATATTAAAAACTTCCATGGTCGTAATATTCGTAGCTATAATGAAGCAATGGCTTCACTTAATAAAGTGTTAGCAAATCCAAAGATGAAAGTAAACAAATCTGATAAGGATGCCATTGTGAATGCCTGGAAACAGGTTAATGCTAAGGACATGGCTAATAAGATTGGTAATCTTGGCAAGGCATTTAAGGTTGCTGATTTAGCTATAAAGGTTGAGAAAATTAGGGAAAAAAGCATTGAGGGATACAATACTGGCAACTGGGGACCTCTCCTGTTGGAGGTTGAATCATGGATCATTGGTGGCGTTGTT------------GCTGGAGTTGCTATTAGTTTATTCGGGGCTGTGTTG---AGTTTTCTCCCAATCTCTGGACTTGCAGTTACTGCGTTGGGGGTAATAGGAATAATGACGATTAGTTACTTGTCATCTTTCATAGATGCAAATCGAGTTTCGAATATAAATAACATTATA
TRN  10010101100011000
NAM  CEA_CITFR/389-587
ASQ  VAEKAKDERELLEKTSELIAGMGDKIGEHLGDKYKAIAKDIADNIKNFQGKTIRSFDDAMASLNKITANPAMKINKADRDALVNAWKHVDAQDMANKLGNLSKAFKVADVVMKVEKVREKSIEGYETGNWGPLMLEVESWVLSGIA----SSVALGIFSATLGAYALSLGVPAIAVGIAGILLAAVVGALIDDKFADALNNEI
DSQ  GTTGCGGAAAAAGCCAAAGATGAGCGGGAGCTGCTTGAAAAAACCAGTGAACTGATTGCTGGTATGGGAGATAAAATCGGCGAGCATCTTGGAGATAAATATAAGGCGATAGCGAAAGATATTGCGGACAATATTAAAAATTTTCAGGGGAAGACCATCCGTAGCTTTGATGATGCAATGGCATCGCTGAATAAAATCACAGCCAACCCAGCCATGAAAATTAATAAGGCGGACAGAGATGCTCTGGTTAATGCCTGGAAACATGTTGATGCTCAGGATATGGCGAATAAACTGGGTAATCTCAGCAAGGCTTTTAAAGTCGCCGACGTGGTGATGAAGGTTGAGAAGGTCCGGGAGAAGAGCATTGAGGGGTATGAAACCGGGAACTGGGGGCCGCTGATGCTGGAGGTGGAATCCTGGGTGCTCAGTGGTATAGCT------------TCCTCTGTTGCTCTGGGGATTTTTTCCGCTACATTAGGAGCATATGCCTTATCTCTTGGAGTTCCTGCTATTGCTGTTGGTATCGCCGGTATTCTACTCGCAGCAGTTGTTGGTGCGTTAATTGATGATAAGTTTGCAGATGCTTTGAATAATGAAATA
TRN  10010101100011010
NAM  O24681_SHIBO/416-614
ASQ  AEEKANDEKAVLTKASEIIISVGDKAGEYLGDKYKVLSREIADNIKNFQGKTIRSYDEAMASVNKLMANPDLKINAADRDAIVNAWKAFDAEDMGNKFAALGKTFKAADYVMKANNVREKSIEGYQTGNWGPLMLEIESWVLSGIA----SAVALSFFSAIFGTFAMLGVFSTSLAGILAVILAGLVGALIDDNFVDKLNNEI
DSQ  GCAGAGGAAAAAGCAAATGATGAGAAGGCTGTTCTGACAAAAGCCAGTGAAATTATCATCAGTGTTGGTGATAAGGCTGGGGAGTATCTGGGTGATAAATATAAAGTTCTTTCTCGTGAGATAGCAGATAATATCAAAAACTTTCAGGGCAAAACGATTCGTAGTTACGATGAGGCGATGGCTTCTGTCAATAAACTGATGGCTAATCCTGATCTTAAAATTAATGCCGCCGACAGGGATGCAATTGTGAATGCCTGGAAAGCATTTGATGCAGAGGATATGGGGAATAAGTTTGCCGCGCTGGGTAAGACGTTTAAAGCCGCAGATTATGTGATGAAGGCAAACAACGTCCGGGAGAAGAGTATCGAGGGGTATCAGACCGGAAACTGGGGGCCGCTGATGCTGGAGATTGAGTCCTGGGTATTGAGTGGTATTGCT------------TCTGCTGTGGCGCTATCATTTTTCTCAGCTATCTTTGGTACTTTTGCTATGCTGGGTGTTTTTTCGACTAGTTTAGCTGGGATCTTGGCTGTTATTTTGGCTGGTTTAGTTGGGGCGTTGATTGATGATAATTTTGTTGATAAGTTAAATAATGAAATT
TRN  10010101100011000
NAM  CEAB_ECOLI/310-508
ASQ  KKEQENDEKTVLTKTSEVIISVGDKVGEYLGDKYKALSREIAENINNFQGKTIRSYDDAMSSINKLMANPSLKINATDKEAIVNAWKAFNAEDMGNKFAALGKTFKAADYAIKANNIREKSIEGYQTGNWGPLMLEVESWVISGMA----SAVALSLFSLTLGSALIAFGLSATVVGFVGVVIAGAIGAFIDDKFVDELNHKI
DSQ  AAGAAAGAACAAGAAAATGACGAGAAGACGGTCCTGACAAAAACCAGCGAGGTCATCATTAGTGTCGGTGACAAAGTCGGGGAATATCTTGGAGATAAATACAAGGCGCTTTCCCGTGAAATTGCAGAGAATATAAATAATTTTCAGGGAAAAACGATTCGTAGTTATGATGATGCAATGTCTTCCATTAATAAGTTAATGGCTAACCCCAGCCTTAAAATAAATGCAACGGACAAAGAAGCCATTGTGAATGCGTGGAAAGCATTTAATGCTGAGGATATGGGGAATAAATTTGCTGCGTTGGGTAAAACGTTCAAAGCAGCAGATTATGCAATAAAGGCAAACAACATCAGGGAGAAGAGTATTGAGGGTTACCAGACTGGTAACTGGGGGCCATTAATGCTGGAAGTCGAGTCCTGGGTTATCAGTGGGATGGCA------------TCTGCTGTAGCTCTTAGTTTGTTTTCTTTGACATTAGGCTCGGCCCTTATAGCCTTTGGTCTTTCGGCCACAGTTGTTGGTTTTGTTGGCGTAGTTATTGCAGGTGCTATTGGTGCATTTATCGATGATAAATTTGTTGATGAGTTGAATCACAAGATC
TRN  10010101100011010
NAM  Q06308_SERMA/258-446
ASQ  --EYQNAELKAIKDGVSLAAGINKDIAEKIGAKYAKLAKDLEAGIQ---GKYIRNVQDAEKTYEQLTKGLNKKLKAQDKAAIVAWLKMIDAEQYARNARVLGKVFTGVDWAIKGADLVNAAIEGFSTGNWKAFRNQLEALGLSIGAGYTLSAIAAFFAPTLVSSTVGIFAFAYLFG---------WATSYIDAERAGELEKWV
DSQ  ------GAATATCAAAATGCGGAATTAAAAGCCATCAAGGATGGCGTCAGCCTGGCCGCAGGTATCAATAAAGATATCGCGGAAAAGATCGGCGCGAAATACGCCAAACTCGCCAAGGATTTGGAGGCGGGAATTCAA---------GGAAAATATATCCGCAACGTGCAAGATGCGGAGAAAACCTACGAGCAATTGACGAAGGGCCTGAACAAAAAGCTCAAGGCGCAGGACAAAGCGGCGATTGTCGCCTGGCTGAAAATGATCGATGCGGAACAGTATGCCCGCAATGCGCGGGTATTGGGCAAGGTCTTCACCGGGGTGGACTGGGCGATCAAGGGCGCGGATCTGGTAAACGCCGCGATTGAAGGTTTCTCTACCGGCAACTGGAAAGCGTTCCGCAACCAGCTCGAAGCGCTCGGGTTGTCGATCGGCGCAGGGTATACGCTTTCCGCTATCGCCGCGTTTTTCGCGCCGACGCTAGTGTCGTCGACGGTGGGCATTTTCGCCTTCGCTTACCTGTTTGGC---------------------------TGGGCCACCAGCTATATCGATGCGGAACGTGCGGGGGAGCTGGAGAAGTGGGTC
TRN  11011101101011010
NAM  CEIB_ECOLI/438-624
ASQ  EEKRKRDEINMVKDAIKLTSDFYRTIYDEFGKQASELAKELASVSQ---GKQIKSVDDALNAFDKFRNNLNKKYNIQDRMAISKALEAINQVHMAENFKLFSKAFGFTGKVIERYDVAVELQKAVKTDNWRPFFVKLESLAAGRAA----SAVTAWAFSVMLGTPVGILGFAIIMA---------AVSALVNDKFIEQVNKLI
DSQ  GAAGAGAAAAGAAAAAGGGATGAAATAAATATGGTAAAGGATGCCATAAAACTCACCTCTGATTTCTACAGAACGATATATGATGAGTTCGGTAAACAAGCATCCGAACTTGCTAAGGAGCTGGCTTCTGTATCTCAA---------GGGAAACAGATTAAGAGTGTGGATGATGCACTGAACGCTTTTGATAAATTCCGTAATAATCTGAACAAGAAATATAACATACAAGATCGCATGGCCATTTCTAAAGCCCTGGAAGCTATTAATCAGGTCCATATGGCGGAGAATTTTAAGCTGTTCAGTAAGGCATTTGGTTTTACCGGAAAAGTTATTGAACGTTATGATGTTGCTGTGGAGTTACAAAAGGCTGTAAAAACGGACAACTGGCGTCCATTTTTTGTAAAACTTGAATCACTGGCAGCAGGAAGAGCTGCT------------TCAGCAGTTACAGCATGGGCGTTTTCCGTCATGCTGGGAACCCCTGTAGGTATTCTGGGTTTTGCAATTATTATGGCG---------------------------GCTGTGAGTGCGCTTGTTAATGATAAGTTTATTGAGCAGGTCAATAAACTTATT
TRN  10010101100011000
NAM  CEIA_ECOLI/438-624
ASQ  EEKRKQDELKATKDAINFTTEFLKSVSEKYGAKAEQLAREMAGQAK---GKKIRNVEEALKTYEKYRADINKKINAKDRAAIAAALESVKLSDISSNLNRFSRGLGYAGKFTSLADWITEFGKAVRTENWRPLFVKTETIIAGNAA----TALVALVFSILTGSALGIIGYGLLMA---------VTGALIDESLVEKANKFW
DSQ  GAAGAGAAAAGAAAACAGGATGAACTGAAGGCAACGAAAGACGCAATTAATTTCACAACAGAGTTCCTGAAATCAGTTTCAGAAAAATATGGTGCAAAAGCTGAGCAGTTAGCCAGAGAGATGGCCGGGCAGGCTAAA---------GGGAAGAAAATACGTAATGTTGAAGAGGCATTAAAAACGTATGAAAAGTACCGGGCTGACATTAACAAAAAAATTAATGCAAAAGATCGTGCAGCGATTGCCGCAGCCCTTGAGTCTGTGAAGCTGTCTGATATATCGTCTAATCTGAACAGATTCAGTCGGGGACTGGGATATGCAGGAAAATTTACAAGTCTTGCTGACTGGATCACTGAGTTTGGTAAGGCTGTCCGGACAGAGAACTGGCGTCCTCTTTTTGTTAAAACAGAAACCATCATAGCAGGCAATGCCGCA------------ACGGCTCTTGTGGCACTGGTCTTCAGTATTCTTACCGGAAGCGCTTTAGGCATTATCGGGTATGGTTTACTGATGGCT---------------------------GTCACCGGTGCGCTGATTGATGAATCGCTTGTGGAAAAAGCGAATAAGTTCTGG
TRN  10010101100011000
NAM  CEAK_ECOLI/360-546
ASQ  KEAQDALEKSQIKDAVDTMVGFYQYITEQYGEKYAKIAQDLAEKSK---GKKIQGVDEALAAFEKYKNVLDKKFSKVDRDAIFNALESVNYDELSKNLTKISKSLKITSRVSFLYDVGSDFKNAIETGNWRPLFVTLEKSAVDVGV----AKIVALMFSFIVGVPLGFWGIAIVTG---------IVSSYIGDDELSKLNELL
DSQ  AAAGAAGCTCAGGATGCTCTTGAAAAGAGCCAGATAAAAGATGCTGTTGATACTATGGTTGGATTTTATCAATATATAACCGAACAATATGGAGAAAAATACGCAAAAATTGCTCAGGATTTAGCGGAAAAGTCTAAA---------GGAAAGAAAATTCAAGGTGTTGATGAAGCTCTGGCAGCATTTGAAAAGTATAAGAATGTACTGGATAAGAAATTCAGTAAGGTTGATCGGGATGCTATTTTTAATGCGTTAGAGTCTGTTAATTATGATGAGTTATCTAAGAATTTAACGAAGATATCAAAGTCGCTTAAAATCACCAGTCGAGTATCTTTTCTATATGATGTTGGTTCTGATTTTAAAAATGCAATAGAAACTGGTAACTGGCGACCTTTGTTTGTCACGCTGGAGAAAAGTGCGGTCGATGTAGGTGTG------------GCAAAAATTGTGGCATTAATGTTTAGTTTTATTGTTGGTGTGCCTCTTGGTTTCTGGGGGATTGCAATTGTCACAGGT---------------------------ATTGTTTCTTCTTACATAGGGGATGATGAGTTGAGCAAACTTAATGAGTTGTTA
TRN  10010101100011000
NAM  CEA1_ECOLI/334-520
ASQ  KKAQNNLLNSQIKDAVDATVSFYQTLTEKYGEKYSKMAQELADKSK---GKKIGNVNEALAAFEKYKDVLNKKFSKADRDAIFNALASVKYDDWAKHLDQFAKYLKITGHVSFGYDVVSDILKIKDTGDWKPLFLTLEKKAADAGV----SYVVALLFSLLAGTTLGIWGIAIVTG---------ILCSYIDKNKLNTINEVL
DSQ  AAAAAAGCACAGAATAATCTCCTTAATTCACAGATTAAGGATGCTGTTGATGCAACAGTTAGCTTTTATCAAACGCTGACTGAAAAATATGGTGAAAAATATTCGAAAATGGCACAGGAACTTGCTGATAAGTCTAAA---------GGTAAGAAAATCGGCAATGTGAATGAAGCTCTCGCTGCTTTTGAAAAATACAAGGATGTTTTAAATAAGAAATTCAGCAAAGCCGATCGTGATGCTATTTTTAATGCGTTGGCATCGGTGAAGTATGATGACTGGGCTAAACATTTAGATCAGTTTGCCAAGTACTTGAAGATTACGGGGCATGTTTCTTTTGGATATGATGTGGTATCTGATATCCTAAAAATTAAGGATACAGGTGACTGGAAGCCACTATTTCTTACATTAGAGAAGAAAGCTGCAGATGCAGGGGTG------------AGTTATGTTGTTGCTTTACTTTTTAGCTTGCTTGCTGGAACTACATTAGGTATTTGGGGTATTGCTATTGTTACAGGA---------------------------ATTCTATGCTCCTATATTGATAAGAATAAACTTAATACTATAAATGAGGTGTTA
TRN  10010101100011000
//