EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01023 - S_100)
FAM  PF01023
PID  S_100
DES  S-100/ICaBP type calcium binding domain
IPR  IPR001751
ANO  27
ALN  44
AID  0.39669
APH  (((((((((S100B_BOVIN/3-46:0.27859,S10A1_BOVIN/4-47:0.30506):0.02395,(S10AB_CHICK/9-52:0.06372,S10AB_HUMAN/10-53:0.21894):0.56619):0.11667,(S10AD_BOVIN/9-51:0.62461,(((S10A6_CHICK/5-46:0.35469,S10I_ICTPU/4-47:0.36454):0.10586,((S10A2_BOVIN/5-48:0.08370,S10A3_HUMAN/5-48:0.66178):0.09292,S10A4_BOVIN/4-47:0.15582):0.10194):0.17334,S10A5_HUMAN/5-45:0.27916):0.07574):0.13769):0.06204,(((S10AA_CHICK/1-44:1.13026,S10A7_BOVIN/6-46:0.68331):0.00000,(S10A8_HUMAN/5-48:0.27565,S10A8_MOUSE/4-47:0.23787):0.59902):0.11687,S100P_HUMAN/4-47:0.50504):0.11129):0.04669,M126_CHICK/14-57:0.24736):0.05074,((S10AC_BOVIN/3-46:0.10879,S10AC_HUMAN/3-46:0.14967):0.30835,((S10A9_BOVIN/4-47:0.11295,S10A9_HUMAN/8-51:0.19526):0.09721,(S10A9_MOUSE/8-51:0.26428,S10A9_RAT/8-51:0.18195):0.06779):0.14600):0.06233):0.35087,Q01720_HUMAN/4-47:0.23272):0.42608,REPT_MOUSE/4-47:0.54647):0.11737,TRHY_RABIT/4-47:0.33504,TRHY_SHEEP/4-47:0.05073);
ATP  (((((((((S100B_BOVIN/3-46,S10A1_BOVIN/4-47),(S10AB_CHICK/9-52,S10AB_HUMAN/10-53)),(S10AD_BOVIN/9-51,(((S10A6_CHICK/5-46,S10I_ICTPU/4-47),((S10A2_BOVIN/5-48,S10A3_HUMAN/5-48),S10A4_BOVIN/4-47)),S10A5_HUMAN/5-45))),(((S10AA_CHICK/1-44,S10A7_BOVIN/6-46),(S10A8_HUMAN/5-48,S10A8_MOUSE/4-47)),S100P_HUMAN/4-47)),M126_CHICK/14-57),((S10AC_BOVIN/3-46,S10AC_HUMAN/3-46),((S10A9_BOVIN/4-47,S10A9_HUMAN/8-51),(S10A9_MOUSE/8-51,S10A9_RAT/8-51)))),Q01720_HUMAN/4-47),REPT_MOUSE/4-47),TRHY_RABIT/4-47,TRHY_SHEEP/4-47);
ATL  12.7919
DNO  21
DLN  132
DID  0.506395
DPH  ((((((((((((S10AB_CHICK/9-52:0.14089,S10AB_HUMAN/10-53:0.17953):0.35142,S10A3_HUMAN/5-48:0.23077):0.10617,(S10A4_BOVIN/4-47:0.06125,S10I_ICTPU/4-47:0.37716):0.10143):0.07964,(S10AD_BOVIN/9-51:0.44459,S10A6_CHICK/5-46:0.16416):0.05157):0.00000,S10AA_CHICK/1-44:0.50340):0.06932,S10A7_BOVIN/6-46:0.37494):0.06433,S100P_HUMAN/4-47:0.31758):0.03649,((S10A9_MOUSE/8-51:0.16224,S10A9_RAT/8-51:0.10564):0.06436,S10A9_HUMAN/8-51:0.13584):0.16916):0.01627,((S10A8_HUMAN/5-48:0.11097,S10A8_MOUSE/4-47:0.23466):0.33079,(S10AC_BOVIN/3-46:0.08028,S10AC_HUMAN/3-46:0.12607):0.14799):0.11420):0.35831,Q01720_HUMAN/4-47:0.11437):0.24530,REPT_MOUSE/4-47:0.33534):0.12656,TRHY_RABIT/4-47:0.16845,TRHY_SHEEP/4-47:0.03739);
DTP  ((((((((((((S10AB_CHICK/9-52,S10AB_HUMAN/10-53),S10A3_HUMAN/5-48),(S10A4_BOVIN/4-47,S10I_ICTPU/4-47)),(S10AD_BOVIN/9-51,S10A6_CHICK/5-46)),S10AA_CHICK/1-44),S10A7_BOVIN/6-46),S100P_HUMAN/4-47),((S10A9_MOUSE/8-51,S10A9_RAT/8-51),S10A9_HUMAN/8-51)),((S10A8_HUMAN/5-48,S10A8_MOUSE/4-47),(S10AC_BOVIN/3-46,S10AC_HUMAN/3-46))),Q01720_HUMAN/4-47),REPT_MOUSE/4-47),TRHY_RABIT/4-47,TRHY_SHEEP/4-47);
DTL  6.81702
RID  0.36922
RPH  (((((((S100P_HUMAN/4-47:0.47655,(S10A8_HUMAN/5-48:0.30779,S10A8_MOUSE/4-47:0.20681):0.63131):0.00098,((S10AB_CHICK/9-52:0.13784,S10AB_HUMAN/10-53:0.15049):0.59788,(S10AD_BOVIN/9-51:0.70361,(S10A4_BOVIN/4-47:0.26237,((S10A3_HUMAN/5-48:0.56941,S10A6_CHICK/5-46:0.26837):0.17298,S10I_ICTPU/4-47:0.37213):0.05953):0.12938):0.11202):0.11277):0.12743,((S10AC_BOVIN/3-46:0.16328,S10AC_HUMAN/3-46:0.09420):0.38985,(S10A9_MOUSE/8-51:0.30987,(S10A9_HUMAN/8-51:0.23939,S10A9_RAT/8-51:0.07204):0.08882):0.21417):0.05628):0.13182,(S10AA_CHICK/1-44:1.05596,S10A7_BOVIN/6-46:0.64107):0.00000):0.30485,Q01720_HUMAN/4-47:0.13289):0.52441,REPT_MOUSE/4-47:0.57149):0.10503,TRHY_RABIT/4-47:0.34247,TRHY_SHEEP/4-47:0.04366);
RTP  (((((((S100P_HUMAN/4-47,(S10A8_HUMAN/5-48,S10A8_MOUSE/4-47)),((S10AB_CHICK/9-52,S10AB_HUMAN/10-53),(S10AD_BOVIN/9-51,(S10A4_BOVIN/4-47,((S10A3_HUMAN/5-48,S10A6_CHICK/5-46),S10I_ICTPU/4-47))))),((S10AC_BOVIN/3-46,S10AC_HUMAN/3-46),(S10A9_MOUSE/8-51,(S10A9_HUMAN/8-51,S10A9_RAT/8-51)))),(S10AA_CHICK/1-44,S10A7_BOVIN/6-46)),Q01720_HUMAN/4-47),REPT_MOUSE/4-47),TRHY_RABIT/4-47,TRHY_SHEEP/4-47);
RTL  10.9121
LNK  M126_CHICK/14-57:P28318:
LNK  Q01720_HUMAN/4-47:Q01720:L01089
LNK  REPT_MOUSE/4-47:P97347:X99251
LNK  S100B_BOVIN/3-46:P02638:
LNK  S100P_HUMAN/4-47:P25815:X65614
LNK  S10A1_BOVIN/4-47:P02639:
LNK  S10A2_BOVIN/5-48:P10462:
LNK  S10A3_HUMAN/5-48:P33764:Z18950
LNK  S10A4_BOVIN/4-47:P35466:D89056
LNK  S10A5_HUMAN/5-45:P33763:
LNK  S10A6_CHICK/5-46:Q98953:U76365
LNK  S10A7_BOVIN/6-46:Q28050:L39834
LNK  S10A8_HUMAN/5-48:P05109:Y00278
LNK  S10A8_MOUSE/4-47:P27005:M83218
LNK  S10A9_BOVIN/4-47:P28783:
LNK  S10A9_HUMAN/8-51:P06702:X06233
LNK  S10A9_MOUSE/8-51:P31725:M83219
LNK  S10A9_RAT/8-51:P50116:L18948
LNK  S10AA_CHICK/1-44:P27003:M38592
LNK  S10AB_CHICK/9-52:P24479:U77733
LNK  S10AB_HUMAN/10-53:P31949:D38583
LNK  S10AC_BOVIN/3-46:P79105:D49548
LNK  S10AC_HUMAN/3-46:P80511:X97859
LNK  S10AD_BOVIN/9-51:P79342:AB001567
LNK  S10I_ICTPU/4-47:Q91061:U33273
LNK  TRHY_RABIT/4-47:P37709:Z19092
LNK  TRHY_SHEEP/4-47:P22793:Z18361
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TRHY_SHEEP/4-47
ASQ  LLRSIFNITKIFNQYASHDCDGTTLSKKDLKNLLEREFGEILRK
DSQ  CTTCTGAGAAGCATCTTTAATATCACTAAAATTTTCAATCAATATGCCTCACATGATTGTGATGGGACAACACTAAGCAAGAAAGACCTGAAGAATCTCCTTGAGAGGGAATTTGGAGAAATCCTTCGGAAA
TRN  10010101100011001
NAM  TRHY_RABIT/4-47
ASQ  LLKSIIDIIEIFNQYASHDCDGAVLKKKDLKILLDREFGAVLQR
DSQ  CTTTTGAAAAGCATCATTGATATTATTGAAATTTTCAACCAATATGCCTCACATGACTGTGATGGGGCAGTACTAAAGAAGAAAGACCTAAAGATCCTTCTTGACAGGGAATTTGGAGCTGTCCTTCAGAGA
TRN  10010101110011001
NAM  REPT_MOUSE/4-47
ASQ  LLNSILNVSKVFQDYAEYHGVGASLSKKELKQLLLTEFGDILRR
DSQ  CTTCTTAATAGCATTCTCAACGTAAGCAAGGTTTTCCAGGACTATGCTGAATATCATGGGGTAGGCGCTTCACTGAGCAAGAAGGAGTTGAAGCAGCTGCTGCTCACTGAGTTTGGAGACATCCTTCGGAGA
TRN  10010101100011001
NAM  Q01720_HUMAN/4-47
ASQ  LLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKN
DSQ  CTCCTGGAAAACATCTTTGCCATAATTAATCTTTTCAAGCAATATTCAAAAAAAGATAAAAACACTGACACATTGAGTAAAAAAGAGCTGAAGGAACTTCTGGAAAAGGAATTTCGGCAAATCCTGAAGAAT
TRN  10010101100011001
NAM  S10AC_HUMAN/3-46
ASQ  LEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKN
DSQ  CTTGAAGAGCATCTGGAGGGAATTGTCAATATCTTCCACCAATACTCAGTTCGGAAGGGGCATTTTGACACCCTCTCTAAGGGTGAGCTGAAGCAGCTGCTTACAAAGGAGCTTGCAAACACCATCAAGAAT
TRN  11011111101111101
NAM  S10AC_BOVIN/3-46
ASQ  LEDHLEGIINIFHQYSVRVGHFDTLNKRELKQLITKELPKTLQN
DSQ  CTGGAAGATCACCTGGAGGGAATCATCAACATCTTCCACCAGTACTCCGTTCGGGTGGGGCATTTCGACACCCTCAACAAGCGTGAGCTGAAGCAGCTGATCACAAAGGAACTTCCCAAAACCCTCCAGAAC
TRN  11011101101011011
NAM  S10A9_RAT/8-51
ASQ  LERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKR
DSQ  CTGGAGCGCAGCATAAGCACCATCATCAATGTTTTCCATCAGTACTCTAGGAAGTATGGACATCCTGACACCCTGAACAAGGCGGAATTCAAAGAAATGGTGAATAAGGACTTGCCAAATTTTCTGAAGAGG
TRN  10010101100011011
NAM  S10A9_HUMAN/8-51
ASQ  LERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKK
DSQ  CTGGAACGCAACATAGAGACCATCATCAACACCTTCCACCAATACTCTGTGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGCTGGTGCGAAAAGATCTGCAAAATTTTCTCAAGAAG
TRN  10010101100011011
NAM  S10A9_BOVIN/4-47
ASQ  MESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKK
NAM  S10A9_MOUSE/8-51
ASQ  MERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKK
DSQ  ATGGAGCGCAGCATAACCACCATCATCGACACCTTCCATCAATACTCTAGGAAGGAAGGACACCCTGACACCCTGAGCAAGAAGGAATTCAGACAAATGGTGGAAGCACAGTTGGCAACCTTTATGAAGAAA
TRN  10010101100011011
NAM  S10I_ICTPU/4-47
ASQ  LQKGMALLISTFHKYSGKEGDKCTLTKGELKDLLTKELGGAFGN
DSQ  CTGCAAAAGGGCATGGCACTGCTCATCTCTACCTTTCATAAATATTCTGGCAAGGAGGGTGACAAATGTACTCTTACCAAGGGAGAGCTAAAAGATCTGCTCACCAAGGAGCTGGGAGGTGCATTCGGGAAC
TRN  11011101101011011
NAM  S10A5_HUMAN/5-45
ASQ  LEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLG---
NAM  S10A6_CHICK/5-46
ASQ  LDQAIGLLVATFHKYSGKEGDKNSLSKGELKELIQKELTIGP--
DSQ  CTGGACCAAGCCATTGGGCTCCTGGTGGCCACTTTCCACAAGTATTCGGGCAAGGAGGGCGACAAGAACAGCCTGAGCAAGGGCGAGCTGAAGGAGCTGATCCAGAAGGAGTTGACCATCGGGCCG------
TRN  11011111101111111
NAM  S10A4_BOVIN/4-47
ASQ  LEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGK
DSQ  CTGGAGAAGGCCCTCGATGTGATGGTGTCCACCTTCCACAAGTACTCGGGCAAGGAGGGTGACAAGTTCAAGCTCAACAAGTCTGAGCTAAAGGAGCTGCTGACCCGGGAGCTGCCCAGCTTCTTGGGGAAA
TRN  11011101101011011
NAM  S10A2_BOVIN/5-48
ASQ  LEQALAVMVATFHKYSGQEGDKFKLSKGEMKELLHKELPSFVGE
NAM  S100B_BOVIN/3-46
ASQ  LEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEE
NAM  S10A1_BOVIN/4-47
ASQ  LETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDA
NAM  S10A3_HUMAN/5-48
ASQ  LEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPT
DSQ  CTGGAGCAGGCGGTAGCTGCCATCGTGTGCACCTTCCAGGAATACGCAGGGCGCTGTGGGGACAAATACAAGCTCTGCCAGGCGGAGCTCAAGGAGCTGCTGCAGAAGGAGCTGGCCACCTGGACCCCGACT
TRN  11011101101011011
NAM  S100P_HUMAN/4-47
ASQ  LETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQS
DSQ  CTAGAGACAGCCATGGGCATGATCATAGACGTCTTTTCCCGATATTCGGGCAGCGAGGGCAGCACGCAGACCCTGACCAAGGGGGAGCTCAAGGTGCTGATGGAGAAGGAGCTACCAGGCTTCCTGCAGAGT
TRN  10010111100111011
NAM  M126_CHICK/14-57
ASQ  LEKAIDVIIDVFHQYSRREGDKDTLTRKELKLLIEKQLANYLKH
NAM  S10AD_BOVIN/9-51
ASQ  LEAAIETVVTTFFTFAGREGRKGSLSVNEFKELVTQQLPHLLK-
DSQ  CTGGAGGCGGCCATTGAGACAGTGGTCACCACCTTCTTCACCTTTGCAGGGCGGGAAGGCAGAAAAGGCAGCCTCAGCGTCAATGAGTTTAAGGAACTGGTCACTCAGCAGTTGCCTCACCTGCTCAAG---
TRN  10010101100011011
NAM  S10A7_BOVIN/6-46
ASQ  LEQAITDLINLFHKYS---GSDDTIEKEDLLRLMKDNFPNFLGA
DSQ  CTTGAGCAGGCCATTACAGACTTGATCAACCTGTTTCACAAATACTCG---------GGATCCGATGACACCATCGAGAAGGAGGACCTGCTGCGGCTGATGAAGGACAACTTCCCCAACTTCCTCGGTGCC
TRN  11011101101011011
NAM  S10AB_HUMAN/10-53
ASQ  TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKN
DSQ  ACTGAGCGGTGCATCGAGTCCCTGATTGCTGTCTTCCAGAAGTATGCTGGAAAGGATGGTTATAACTACACTCTCTCCAAGACAGAGTTCCTAAGCTTCATGAATACAGAACTAGCTGCCTTCACAAAGAAC
TRN  11011111101111111
NAM  S10AB_CHICK/9-52
ASQ  TERCIESLLAVFQRYAGREGDNLKLSKKEFRTFMNTELASFTKN
DSQ  ACCGAGCGCTGCATTGAGTCGCTGCTGGCCGTCTTCCAGAGGTACGCAGGGCGTGAAGGAGACAACCTCAAGCTCTCCAAGAAAGAATTCCGGACTTTCATGAACACCGAGCTGGCTTCCTTCACAAAGAAT
TRN  10010101100011011
NAM  S10A8_MOUSE/4-47
ASQ  LEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQN
DSQ  CTGGAGAAGGCCTTGAGCAACCTCATTGATGTCTACCACAATTATTCCAATATACAAGGAAATCACCATGCCCTCTACAAGAATGACTTCAAGAAAATGGTCACTACTGAGTGTCCTCAGTTTGTGCAGAAT
TRN  10010101100011011
NAM  S10A8_HUMAN/5-48
ASQ  LEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRK
DSQ  CTGGAGAAAGCCTTGAACTCTATCATCGACGTCTACCACAAGTACTCCCTGATAAAGGGGAATTTCCATGCCGTCTACAGGGATGACCTGAAGAAATTGCTAGAGACCGAGTGTCCTCAGTATATCAGGAAA
TRN  10010101100011011
NAM  S10AA_CHICK/1-44
ASQ  PSQMEHAMETLMFTFHKYAGDKNYLSKEDLRALMEKEFPGFLEN
DSQ  CCGTCCCAGATGGAGCACGCCATGGAGACGCTGATGTTCACCTTCCACAAATACGCGGGTGACAAGAACTACCTGAGCAAGGAGGACCTGCGTGCGCTGATGGAGAAGGAGTTCCCCGGATTCCTGGAGAAC
TRN  11011101101011011
//