EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00992 - Troponin)
FAM  PF00992
PID  Troponin
DES  Troponin
IPR  IPR001978
ANO  21
ALN  147
AID  0.337888
APH  ((((((Q90350_COTCO/16-147:0.26421,(((O13093_SALSA/11-139:0.42074,(O13094_SALSA/13-143:0.35112,Q90365_CLUHA/11-140:0.26651):0.09217):0.13751,(TNNI2_COTJA/14-144:0.12419,TNNI2_HUMAN/14-144:0.11464):0.08519):0.13810,((TNNI3_CHICK/1-129:0.42899,TNNI3_BOVIN/47-178:0.20370):0.04192,TNNI3_XENLA/70-201:0.11637):0.09802):0.08173):0.15511,(O01354_HALRO/15-147:0.09049,O01355_HALRO/13-145:0.14676):0.07410):0.01893,(Q20334_CAEEL/58-191:0.53005,(TRI_DROME/104-233:0.21790,TRI_PONLE/46-175:0.14785):0.26353):0.86044):0.85169,O15987_PATYE/99-241:4.23303):1.87266,(Q98916_CHICK/73-214:0.22100,(TRT2_MOUSE/105-249:0.19571,(Q25148_HALRO/44-187:0.19457,Q25149_HALRO/34-177:0.29077):0.25313):0.04057):0.04407):0.08972,TRT3_MOUSE/75-217:0.03923,TRT3_CHICK/68-210:0.05274);
ATP  ((((((Q90350_COTCO/16-147,(((O13093_SALSA/11-139,(O13094_SALSA/13-143,Q90365_CLUHA/11-140)),(TNNI2_COTJA/14-144,TNNI2_HUMAN/14-144)),((TNNI3_CHICK/1-129,TNNI3_BOVIN/47-178),TNNI3_XENLA/70-201))),(O01354_HALRO/15-147,O01355_HALRO/13-145)),(Q20334_CAEEL/58-191,(TRI_DROME/104-233,TRI_PONLE/46-175))),O15987_PATYE/99-241),(Q98916_CHICK/73-214,(TRT2_MOUSE/105-249,(Q25148_HALRO/44-187,Q25149_HALRO/34-177)))),TRT3_MOUSE/75-217,TRT3_CHICK/68-210);
ATL  14.0786
DNO  19
DLN  441
DID  0.454516
DPH  (Q90350_COTCO/16-147:0.23652,(((((O13093_SALSA/11-139:0.22655,Q90365_CLUHA/11-140:0.21525):0.07888,O13094_SALSA/13-143:0.20691):0.11223,(TNNI2_COTJA/14-144:0.17009,TNNI2_HUMAN/14-144:0.11645):0.08069):0.04790,((O01354_HALRO/15-147:0.12113,O01355_HALRO/13-145:0.19455):0.19075,(Q20334_CAEEL/58-191:0.44700,TRI_DROME/104-233:0.30609):0.37052):0.13526):0.05214,TNNI3_XENLA/70-201:0.21458):0.03551,((((((O15987_PATYE/99-241:2.14323,Q25149_HALRO/34-177:0.07129):0.22844,Q25148_HALRO/44-187:0.18591):0.31432,TRT2_MOUSE/105-249:0.15804):0.04772,(TRT3_MOUSE/75-217:0.13008,TRT3_CHICK/68-210:0.12512):0.09715):0.12658,Q98916_CHICK/73-214:0.11939):0.88782,TNNI3_CHICK/1-129:0.26246):0.12184);
DTP  (Q90350_COTCO/16-147,(((((O13093_SALSA/11-139,Q90365_CLUHA/11-140),O13094_SALSA/13-143),(TNNI2_COTJA/14-144,TNNI2_HUMAN/14-144)),((O01354_HALRO/15-147,O01355_HALRO/13-145),(Q20334_CAEEL/58-191,TRI_DROME/104-233))),TNNI3_XENLA/70-201),((((((O15987_PATYE/99-241,Q25149_HALRO/34-177),Q25148_HALRO/44-187),TRT2_MOUSE/105-249),(TRT3_MOUSE/75-217,TRT3_CHICK/68-210)),Q98916_CHICK/73-214),TNNI3_CHICK/1-129));
DTL  8.57841
RID  0.337558
RPH  (((((((((TNNI2_COTJA/14-144:0.12422,TNNI2_HUMAN/14-144:0.11420):0.08266,(O13093_SALSA/11-139:0.41911,(O13094_SALSA/13-143:0.35460,Q90365_CLUHA/11-140:0.26420):0.09034):0.14460):0.11106,(TNNI3_CHICK/1-129:0.45878,TNNI3_XENLA/70-201:0.10121):0.11307):0.10279,Q90350_COTCO/16-147:0.26017):0.10114,(O01354_HALRO/15-147:0.08607,O01355_HALRO/13-145:0.15085):0.13306):0.00000,(Q20334_CAEEL/58-191:0.60465,TRI_DROME/104-233:0.38718):0.78289):1.00769,O15987_PATYE/99-241:4.40002):1.92051,(Q98916_CHICK/73-214:0.22133,(TRT2_MOUSE/105-249:0.19542,(Q25148_HALRO/44-187:0.19498,Q25149_HALRO/34-177:0.29145):0.25484):0.04008):0.03107):0.10335,TRT3_MOUSE/75-217:0.04010,TRT3_CHICK/68-210:0.05204);
RTP  (((((((((TNNI2_COTJA/14-144,TNNI2_HUMAN/14-144),(O13093_SALSA/11-139,(O13094_SALSA/13-143,Q90365_CLUHA/11-140))),(TNNI3_CHICK/1-129,TNNI3_XENLA/70-201)),Q90350_COTCO/16-147),(O01354_HALRO/15-147,O01355_HALRO/13-145)),(Q20334_CAEEL/58-191,TRI_DROME/104-233)),O15987_PATYE/99-241),(Q98916_CHICK/73-214,(TRT2_MOUSE/105-249,(Q25148_HALRO/44-187,Q25149_HALRO/34-177)))),TRT3_MOUSE/75-217,TRT3_CHICK/68-210);
RTL  13.897
LNK  O01354_HALRO/15-147:O01354:AB001685
LNK  O01355_HALRO/13-145:O01355:AB001686
LNK  O13093_SALSA/11-139:O13093:U83878
LNK  O13094_SALSA/13-143:O13094:U84393
LNK  O15987_PATYE/99-241:O15987:AB008005
LNK  Q20334_CAEEL/58-191:Q20334:Z66562
LNK  Q25148_HALRO/44-187:Q25148:D50867
LNK  Q25149_HALRO/34-177:Q25149:D85077
LNK  Q90350_COTCO/16-147:Q90350:U37118
LNK  Q90365_CLUHA/11-140:Q90365:U20111
LNK  Q98916_CHICK/73-214:Q98916:D85105
LNK  TNNI2_COTJA/14-144:P68247:M12132
LNK  TNNI2_HUMAN/14-144:P48788:L21715
LNK  TNNI3_BOVIN/47-178:P08057:
LNK  TNNI3_CHICK/1-129:P27673:M73703
LNK  TNNI3_XENLA/70-201:P50754:L25721
LNK  TRI_DROME/104-233:P36188:AE003507
LNK  TRI_PONLE/46-175:P05547:
LNK  TRT2_MOUSE/105-249:P50752:L47549
LNK  TRT3_CHICK/68-210:P12620:M22156
LNK  TRT3_MOUSE/75-217:Q9QZ47:L49466
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TRT3_CHICK/68-210
ASQ  KRQNKDLIELQALIDSHFEARRKEEEELVALKER-IEKRRAERAEQQRIRAEKEKERQARLAEEKARREEEDAKRKAEDDLKKKKALSSMGASYSSYLAKADQ-..KRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELW
DSQ  AAGAGGCAGAACAAAGACCTGATTGAACTGCAGGCCTTGATTGACAGCCACTTTGAGGCCAGGCGAAAGGAAGAAGAAGAGCTGGTTGCCCTTAAGGAGAGG---ATTGAGAAACGCAGAGCTGAAAGAGCAGAGCAACAGAGAATCCGGGCTGAGAAGGAGAAGGAGCGTCAAGCACGGCTTGCGGAGGAAAAGGCACGGAGAGAGGAAGAAGATGCCAAGAGAAAAGCCGAGGATGATCTCAAGAAGAAGAAGGCTCTGTCCTCCATGGGTGCCTCATACAGCAGCTATCTGGCAAAGGCTGATCAG---......AAGAGAGGGAAGAAGCAAACAGCTAGAGAGACAAAGAAGAAGGTCCTGGCAGAGAGGCGCAAGCCCTTGAACATTGACCATCTTAATGAAGACAAGCTGAGGGACAAGGCTAAGGAACTGTGG
TRN  10010101100011001
NAM  TRT3_MOUSE/75-217
ASQ  KRQNKDLMELQALIDSHFEARKKEEEELIALKER-IEKRRAERAEQQRIRAEKEREPQNRLAEEKARREEEDAKRRAEDDMKKKKALSSMGANYSSYLAKADQK..-RGKKQTAREMKKKILAERRKPLNIDHLSDDKLRDKAKELW
DSQ  AAGCGTCAAAACAAGGACCTCATGGAGCTCCAAGCCCTCATTGACAGCCACTTTGAAGCTAGAAAGAAAGAAGAAGAGGAGCTAATCGCACTTAAAGAAAGA---ATTGAGAAGCGCCGTGCAGAGAGGGCTGAGCAGCAAAGAATTCGCGCTGAGAAGGAGCGGGAACCGCAGAACAGATTGGCGGAGGAGAAGGCCAGAAGAGAGGAGGAGGATGCCAAGAGGAGAGCTGAAGATGACATGAAGAAGAAAAAGGCTCTGTCCTCCATGGGTGCCAACTACAGCAGCTACCTGGCCAAGGCTGACCAGAAG......---AGAGGCAAGAAACAGACAGCCCGGGAAATGAAAAAGAAGATTCTTGCCGAAAGGCGCAAGCCTCTGAACATTGACCATCTTAGCGATGACAAGCTGAGGGACAAGGCCAAGGAACTCTGG
TRN  10010101100011011
NAM  TRT2_MOUSE/105-249
ASQ  KRVEKDLNELQTLIEAHFENRKKEEEELISLKDR-IEKRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNM-MHFGGYIQKQAQTerKSGKRQTEREKKKKILAERRKALAIDHLNEDQLREKAKELW
DSQ  AAGCGCGTGGAGAAGGACCTGAATGAGCTACAGACTCTGATCGAGGCTCACTTCGAGAACAGGAAGAAGGAGGAAGAGGAGCTGATTTCCCTCAAAGACAGG---ATCGAAAAGCGTCGGGCAGAGCGGGCCGAGCAGCAGCGTATTCGCAATGAGCGGGAGAAGGAAAGGCAGAACCGCCTGGCTGAAGAGAGGGCCCGGCGTGAGGAGGAGGAGAACAGGAGGAAGGCTGAGGATGAGGCCCGGAAGAAGAAGGCTCTGTCCAACATG---ATGCACTTTGGAGGGTACATCCAGAAGCAAGCTCAGACAgagcggAAGAGTGGGAAGAGACAGACAGAGAGAGAGAAGAAGAAGAAGATCCTGGCAGAGAGGAGGAAGGCGCTGGCCATCGACCACCTGAATGAAGACCAACTGAGAGAGAAGGCCAAGGAGCTGTGG
TRN  10010101100011011
NAM  Q98916_CHICK/73-214
ASQ  KRMEKDLLELQTLIDAHFEQRRREENELVALMER-IERRRAERNEQLRSRTEKERERQARLAEEKLRKEEEEAKKRAEDDAKKKKVLSNM-PHFGGYLAKAEQ-..RRGKRQTGREMKLRILAERKKPLHIEHMREDELRAKAKELH
DSQ  AAGCGCATGGAGAAGGACCTGCTGGAGCTGCAGACCCTCATTGACGCCCACTTCGAGCAGCGGCGCCGCGAGGAGAACGAGCTGGTGGCACTGATGGAGCGC---ATTGAACGGCGCCGGGCGGAGCGCAACGAGCAGCTGCGGAGCCGCACGGAGAAGGAGCGCGAGCGGCAAGCAAGGCTGGCAGAGGAGAAGCTCCGCAAGGAGGAGGAGGAGGCCAAGAAGCGAGCCGAGGATGACGCCAAGAAGAAGAAAGTCCTGTCCAACATG---CCCCACTTCGGGGGGTACCTGGCCAAGGCGGAGCAG---......CGGCGTGGGAAGCGGCAGACGGGGCGGGAGATGAAGCTGCGCATCCTGGCTGAGCGCAAGAAGCCCCTCCACATTGAGCACATGCGGGAGGATGAGCTGCGGGCCAAGGCCAAGGAGCTGCAC
TRN  10010101100011011
NAM  Q25149_HALRO/34-177
ASQ  KRMDKVLLELQSLISSHFETRKRAGGEIDQLRIR-IEERKACREEQMRVRQEKEKERMAREREDRKRKEEEEGQKRFEEEAKRKAAIANMSLHYGGYLARPIKI..SPNKRQTDREKKKKILSDRRKPLNVDHLSAEKLQEKASELW
DSQ  AAAAGAATGGACAAGGTTCTTCTTGAATTGCAAAGTTTAATCAGTAGTCATTTTGAAACTCGTAAAAGGGCCGGGGGGGAAATTGACCAGTTGCGCATTCGT---ATTGAGGAACGAAAGGCATGTCGTGAAGAGCAAATGCGCGTAAGACAAGAAAAGGAAAAAGAGCGAATGGCACGGGAAAGGGAAGACCGCAAAAGAAAGGAAGAAGAGGAGGGGCAAAAGAGATTCGAAGAGGAAGCCAAGAGGAAAGCAGCCATTGCAAATATGTCACTGCATTATGGAGGTTATCTTGCTCGGCCGATCAAGATA......AGCCCAAACAAGAGACAGACTGATAGAGAAAAGAAGAAGAAGATTTTGTCCGACCGAAGAAAACCCCTGAATGTTGATCATCTAAGCGCTGAAAAGCTTCAAGAAAAGGCAAGCGAGCTGTGG
TRN  10010101100011000
NAM  Q25148_HALRO/44-187
ASQ  KRHQKDLEELQALITAHFEQRKQEEEQLEELRLR-LEKRKEERAERLRIREEKTKERVAREREERKHKEEEDEKKRKEEEEKKKAAIANMSLHYGGYLARAEKN..KPNKRQTEREKKKKLLAERKKNISVDHLSPDKLREKAQELW
DSQ  AAACGTCATCAGAAAGATCTTGAGGAATTGCAAGCTCTGATCACGGCGCATTTCGAACAACGTAAACAAGAAGAAGAGCAGCTAGAGGAACTTCGACTCAGA---CTTGAAAAGCGTAAGGAAGAACGTGCTGAGAGACTCCGAATACGCGAAGAGAAGACAAAAGAAAGAGTTGCACGGGAACGGGAAGAGAGGAAACACAAAGAAGAGGAGGATGAGAAAAAGCGCAAAGAGGAAGAAGAGAAAAAGAAGGCAGCAATTGCAAACATGTCTCTGCATTATGGCGGCTACCTGGCTCGGGCTGAGAAAAAC......AAACCGAACAAGCGTCAAACTGAAAGAGAAAAGAAGAAGAAACTTCTTGCTGAAAGAAAAAAGAATATATCTGTTGATCACCTAAGCCCCGACAAGCTGAGAGAAAAAGCTCAGGAATTGTGG
TRN  10010101100011011
NAM  TRI_PONLE/46-175
ASQ  KKKLRLLLRKKAAEELKKEQERKAGERRKIIDQRCGQPKNLDGANE-EQLRAIIKEYFDHTA--QIESDKYDVELEIIRKDYEINELNIQVNDLRGKFIKPTLK..--KVSKYENKFAKLQKKA---------AEFN-FRNQLKTVK
NAM  TRI_DROME/104-233
ASQ  KKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASE-GELQEICEEYYERMY--ICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALK..--KVSKYENKFAKLQKKA---------AEFN-FRNQLKVVK
DSQ  AAGAAGAAACTCAGGTTGCTGCTGCGTAAGAAAGCCGCTGAGGAGCTGAAGAAAGAACAGGAACGCAAAGCGGCTGAACGTAGACGCATCATCGAAGAACGTTGCGGCAGTCCCAGGAATCTCAGCGATGCCAGCGAA---GGCGAATTGCAAGAGATTTGCGAAGAGTATTACGAGCGTATGTAT------ATTTGTGAAGGCCAGAAATGGGATCTGGAATACGAAGTCAGGAAAAAAGACTGGGAGATCAACGATCTCAATGCCCAAGTTAACGATCTTCGCGGCAAGTTCGTCAAGCCAGCCCTGAAG......------AAGGTCTCCAAATACGAAAACAAATTCGCCAAGCTGCAGAAGAAGGCC---------------------------GCTGAGTTCAAC---TTCCGCAACCAGCTCAAGGTGGTGAAG
TRN  10010101100011011
NAM  Q20334_CAEEL/58-191
ASQ  KKKLRKLLMNKAAEDLKTQQLRKEQERVKVLAERTVALPNVDSIDDHAKLEAIYNDLFSRLC--NLEEEKYDINHITTETETTINQLNIEVNDLRGKFVKPSLK..--KVSKYDNKFKKMAEAKKED------GSKN-LRNNLKTVK
DSQ  AAGAAGAAGCTCCGCAAGCTTCTTATGAACAAGGCTGCTGAGGATCTTAAGACACAGCAATTGCGGAAGGAACAAGAAAGAGTCAAGGTCCTTGCTGAAAGAACCGTTGCTCTTCCAAATGTTGACAGCATTGATGATCACGCTAAGCTCGAGGCTATCTACAATGATTTGTTCTCCCGCCTCTGC------AACTTGGAGGAAGAGAAATATGATATCAACCACATCACCACAGAGACTGAAACTACAATTAATCAACTCAACATTGAGGTTAACGATCTTCGTGGAAAATTCGTAAAACCATCATTGAAG......------AAGGTGTCCAAGTATGACAACAAGTTCAAGAAGATGGCTGAAGCCAAGAAGGAAGAT------------------GGAAGCAAGAAC---TTGAGAAATAATCTCAAGACAGTAAAG
TRN  10010101110011001
NAM  TNNI2_HUMAN/14-144
ASQ  RQHLKSVMLQIAATELEKEESRREAEKQNYLAEH-CPPLHIPGS--MSEVQELCKQLHAKID--AAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLR..--RVRMSADAMLKALLGSKHK------VCMD-LRANLKQVK
DSQ  AGGCAGCACCTGAAGAGCGTGATGCTGCAGATAGCGGCCACGGAGCTGGAGAAGGAGGAGAGCCGCCGTGAGGCAGAGAAGCAGAACTACCTGGCGGAGCAC---TGCCCGCCGCTGCATATCCCGGGCTCC------ATGTCTGAAGTGCAGGAGCTCTGCAAACAGCTGCACGCCAAGATCGAT------GCGGCTGAAGAGGAGAAGTACGACATGGAGGTGAGGGTGCAGAAGACCAGCAAGGAGCTGGAGGACATGAACCAGAAGCTATTTGATCTGCGGGGCAAGTTCAAGCGGCCCCCACTGCGG......------AGGGTGCGCATGTCGGCCGATGCCATGCTCAAGGCCCTGCTGGGCTCGAAGCACAAG------------------GTGTGCATGGAC---CTGAGGGCCAACCTGAAGCAGGTCAAG
TRN  10010101100011011
NAM  TNNI2_COTJA/14-144
ASQ  RQHLKSAMLQLAVTEIEKEAAAKEVEKQNYLAEH-CPPLSLPGS--MQELQELCKKLHAKID--SVDEERYDTEVKLQKTNKELEDLSQKLFDLRGKFKRPPLR..--RVRMSADAMLRALLGSKHK------VNMD-LRANLKQVK
DSQ  CGGCAGCACCTGAAGAGTGCTATGCTCCAGCTTGCTGTCACTGAAATAGAAAAAGAAGCAGCTGCTAAAGAAGTGGAAAAGCAAAACTACCTAGCAGAGCAT---TGCCCTCCTCTGTCCCTCCCAGGATCC------ATGCAGGAACTTCAGGAACTGTGCAAAAAGCTTCACGCCAAGATAGAT------TCAGTGGATGAGGAAAGGTATGACACAGAGGTGAAGCTACAGAAGACTAACAAGGAGCTGGAGGACCTGAGCCAGAAGCTGTTTGACCTGAGGGGCAAGTTCAAGAGGCCACCCCTGCGC......------AGGGTGCGTATGTCCGCTGATGCCATGCTGCGTGCCCTGCTAGGCTCCAAGCACAAA------------------GTCAACATGGAC---CTCCGGGCCAACCTGAAGCAAGTCAAG
TRN  10010101100011001
NAM  TNNI3_XENLA/70-201
ASQ  KLQLNTMMLQIAKAEMEREEEERAREKERYLAEH-CQPLQLSGLS-RSELQDLCQELHARID--VVDEERYDMEAKVNKNITELEDLNQKIFDLRGKFKKPNLR..--RVRLSADAMMMALLGTKHK------VSMD-LRANLKQVK
DSQ  AAGCTCCAACTGAACACTATGATGTTGCAAATTGCTAAGGCAGAAATGGAACGTGAGGAAGAGGAGAGAGCTCGCGAGAAGGAGAGATACCTTGCAGAACAC---TGTCAGCCTCTGCAACTGTCTGGCTTGTCC---CGATCTGAACTGCAGGACCTGTGTCAGGAGCTTCATGCAAGAATCGAT------GTAGTAGATGAAGAAAGATATGACATGGAAGCCAAAGTAAACAAAAACATAACTGAGCTCGAAGACTTGAACCAAAAGATCTTTGACCTCCGTGGCAAGTTCAAAAAGCCAAACCTCAGG......------AGGGTGCGTCTCTCTGCCGACGCCATGATGATGGCGCTGTTGGGCACCAAGCACAAA------------------GTCTCCATGGAT---CTACGGGCCAATCTCAAACAGGTCAAG
TRN  10010101100011011
NAM  TNNI3_BOVIN/47-178
ASQ  KLQLKTLMLQIAKQELEREAEERRGEKGRALSTR-CQPLELAGLG-FAELQDLCRQLHARVD--KVDEERYDVEAKVTKNITEIADLNQKIFDLRGKFKRPTLR..--RVRISADAMMQALLGARAK------ETLD-LRAHLKQVK
NAM  Q90350_COTCO/16-147
ASQ  KLLLKSLMLAKAKEEWDQEIVDKQSEKERYLSER-ITPLHTSGLS-LSQLQDLCRELHEKVE--IVDEERYDIEAKCNHNTREIKDLKLKVLDLRGKFKRPPLR..--RVRVSADAMLRALLGSKHK------VSMD-LRANLKSVK
DSQ  AAACTCCTGTTGAAGAGCTTGATGCTGGCAAAAGCCAAGGAGGAGTGGGATCAGGAGATCGTGGACAAACAGTCGGAGAAGGAGAGATACCTGTCTGAGCGC---ATCACCCCGCTGCACACCAGTGGGCTCTCC---TTGAGCCAGCTTCAGGATCTGTGCCGGGAGCTGCATGAGAAGGTGGAG------ATTGTGGATGAAGAGAGATATGACATCGAAGCAAAGTGCAACCATAACACTAGGGAGATTAAAGACCTGAAGCTCAAAGTGCTCGACCTGAGAGGGAAGTTCAAACGACCCCCGCTGCGG......------AGGGTCCGTGTCTCAGCTGATGCCATGCTGAGGGCTCTGCTGGGCTCCAAGCACAAG------------------GTGTCCATGGAC---CTGAGAGCCAACCTGAAGTCTGTCAAG
TRN  10010101100011001
NAM  O01355_HALRO/13-145
ASQ  KLQLKSLLLNRAREDLKREAEQKAEEKKKILNNR-IESLGDLSSMSQQELMELCRELHAKTD--KVDDERFDIELKVKKNDQEIEELNQKIFELRGKFKRPPLR..--RVRMSADQMLRALLGSKHK------VTMD-LRSNLKTVK
DSQ  AAACTGCAGCTCAAGTCTCTTTTGCTCAACAGAGCCCGGGAGGATTTGAAAAGAGAAGCTGAACAAAAAGCAGAAGAGAAAAAGAAGATTTTGAACAACAGA---ATCGAATCTCTCGGGGACTTATCTAGCATGTCGCAACAAGAACTGATGGAATTATGCCGAGAACTCCACGCAAAAACAGAC------AAAGTCGACGATGAAAGATTTGACATCGAATTAAAAGTGAAAAAGAACGACCAAGAGATCGAAGAACTAAATCAGAAAATCTTTGAACTCCGAGGTAAATTCAAACGCCCACCTCTGAGA......------CGTGTCCGTATGTCTGCTGACCAAATGTTGCGCGCCCTCCTGGGATCAAAACACAAA------------------GTTACAATGGAT---CTTAGATCCAACCTCAAGACAGTCAAA
TRN  10010101100011000
NAM  O01354_HALRO/15-147
ASQ  KQNLKSLMLNKAREDLKREAEVKAEEKKKILNSR-IEPLSNLGGMSEQDLKDLCRELHAKIE--KVDEQRYDIEVKVNKNDQEIEDLNQRIFDLRGKFKRPPLR..--RVRMSADQMLRALLGSKHK------VSMD-LRSSLKSVK
DSQ  AAGCAAAATCTCAAATCTCTGATGCTTAACAAGGCCCGCGAAGATTTGAAACGCGAGGCGGAAGTTAAAGCTGAAGAGAAAAAGAAAATTCTCAACAGCAGA---ATCGAACCGCTCTCTAACCTTGGTGGCATGTCAGAGCAAGACCTGAAGGATCTTTGCAGAGAACTGCACGCGAAAATTGAA------AAAGTCGACGAACAAAGATACGACATCGAGGTGAAAGTCAACAAGAATGACCAAGAGATAGAGGATCTTAACCAGAGGATATTCGATCTTCGCGGCAAGTTCAAACGACCTCCACTGCGC......------AGAGTCCGCATGTCAGCCGACCAAATGCTCCGCGCCCTCCTCGGATCCAAGCACAAA------------------GTGTCTATGGAT---CTCCGATCAAGCCTAAAATCCGTCAAG
TRN  10010101100011001
NAM  TNNI3_CHICK/1-129
ASQ  KLQLKTLLLQRAKRELEREEQERAGEKQRHLGGL-CPPPELEGLG-VAQLQELCRELHARI---AVDEERYDMGTRVSKNMAEMEELRRRVAGGR--FVRPALR..--RVRLSADAMMAALLGSKHR------VGTD-LRAGLRQVR
DSQ  AAGCTGCAGCTCAAGACGTTGCTGCTGCAGAGAGCAAAGCGGGAGTTGGAGCGCGAGGAGCAGGAGAGGGCAGGAGAGAAACAGCGGCACCTGGGGGGACTG---TGCCCCCCCCCGGAGCTGGAGGGCTTGGGG---GTGGCCCAGCTGCAGGAGCTGTGCCGGGAGCTGCACGCCCGCATA---------GCGGTGGATGAGGAGCGCTACGACATGGGGACGCGCGTCAGCAAGAACATGGCCGAGATGGAGGAGCTGCGGCGCCGCGTGGCCGGGGGTCGC------TTTGTTCGCCCCGCGCTGCGC......------CGCGTGCGGCTGTCGGCCGACGCCATGATGGCGGCGCTGCTGGGCTCCAAGCACCGC------------------GTGGGGACCGAC---CTGAGGGCCGGGCTGCGGCAGGTGCGG
TRN  10010101100011011
NAM  Q90365_CLUHA/11-140
ASQ  KHHLKSVMLAIAATRLEQEAADAIAAKETYLSDN-CPSLDYPSS--IEDLQKLCKELHSKID--IVDEDRYDAESKVTKGAKEVEDLLFKVTELKG-MKKPALK..--KVRLSADQMLQALLGSKHK------VSMD-LRSNLKQVK
DSQ  AAGCATCACCTGAAGAGCGTGATGCTTGCAATTGCTGCAACGCGGCTTGAACAGGAAGCGGCCGATGCGATAGCAGCCAAGGAGACGTACCTGAGTGACAAC---TGCCCATCCCTTGATTACCCCAGCAGT------ATTGAGGACCTTCAGAAACTGTGCAAAGAGCTACATTCGAAGATTGAC------ATAGTTGATGAGGACAGATACGACGCAGAGTCCAAAGTAACGAAGGGAGCAAAAGAGGTTGAAGACCTGTTGTTCAAGGTAACAGAATTGAAGGGT---ATGAAGAAGCCAGCTCTGAAG......------AAAGTGCGCTTGTCCGCTGATCAGATGCTTCAGGCTCTGCTGGGCTCCAAGCACAAG------------------GTCAGCATGGAC---CTGAGATCCAACCTGAAGCAGGTGAAG
TRN  10010101100011011
NAM  O13094_SALSA/13-143
ASQ  KHTLKSCMLALAKDWLEAEALEKVKERERYMAEN-CPPLEMSHS--KEDLMELCKKMYDKIN--VIDEERYNLEYKVIMVCNEVLDLNIKIVDLRGKFKKPALK..--KVRMSADAMLQALLGSKHK------VTMD-LRSNLKQVK
DSQ  AAGCACACTCTGAAGAGTTGTATGCTGGCACTTGCTAAGGATTGGCTTGAAGCTGAAGCATTAGAGAAAGTTAAAGAGAGGGAGAGATACATGGCAGAGAAC---TGCCCTCCTCTGGAGATGTCCCACTCC------AAGGAAGATTTGATGGAGCTTTGCAAGAAGATGTACGACAAAATTAAT------GTGATTGATGAAGAGAGATACAACTTAGAATATAAAGTGATCATGGTTTGCAATGAGGTTTTAGACCTAAACATCAAAATAGTTGACCTGAGGGGAAAGTTCAAGAAGCCAGCTCTGAAG......------AAAGTGCGTATGTCTGCTGATGCTATGCTCCAGGCTCTGCTGGGCTCCAAGCACAAG------------------GTGACCATGGAT---TTGAGATCCAACCTGAAACAAGTGAAG
TRN  10010101100011010
NAM  O13093_SALSA/11-139
ASQ  KHHLKSLMLQIAANLIEEEKKEMKQEKVNFMAN--IPALDLSGD--QAMLMEMLKKLSQTID--KVDEERYDAEAKVKKTEKEIEDLKMKVIEVQG-IKKPALK..--KVRMSADAMLAALLGTKHK------ASMD-FRANLKEVK
DSQ  AAGCATCATCTGAAGAGCTTGATGCTTCAGATTGCAGCCAATTTGATTGAAGAGGAGAAAAAGGAGATGAAGCAGGAGAAAGTGAATTTCATGGCTAAC------ATCCCCGCCCTGGATTTGTCTGGAGAT------CAAGCAATGCTGATGGAAATGCTCAAAAAGTTGTCCCAGACCATCGAC------AAGGTTGATGAGGAAAGATATGACGCAGAAGCAAAAGTGAAGAAGACAGAAAAAGAGATTGAGGACTTGAAGATGAAAGTGATTGAGGTTCAGGGC---ATCAAGAAGCCAGCTCTGAAG......------AAAGTGCGTATGTCTGCTGATGCTATGCTTGCAGCTCTGCTGGGCACCAAGCACAAG------------------GCTTCCATGGAC---TTTAGAGCCAACTTGAAAGAAGTGAAG
TRN  10010101100011011
NAM  O15987_PATYE/99-241
ASQ  NRQQEELRRQRQEEERQRREEEQRRQQEEEERLRLEREEQEREEEARRMAEEQKKKKKKGLGGLSPEKKKMLKKLIMQKAAEDLKNEAKAKAEAKEKYINDLVP..KFSTDGKDVAALQALCKDFHKKLAS--LEEDVYDWEAKIRK
DSQ  AACAGACAGCAGGAAGAACTACGTCGCCAGCGCCAAGAAGAAGAAAGACAGAGGCGGGAAGAAGAGCAAAGGAGACAACAGGAAGAGGAAGAGCGGTTGAGACTTGAACGGGAAGAACAGGAGAGAGAAGAGGAAGCCAGAAGAATGGCGGAGGAACAAAAGAAGAAAAAAAAGAAGGGTCTGGGTGGTCTTTCCCCAGAGAAGAAGAAGATGTTGAAAAAACTCATCATGCAAAAGGCAGCAGAGGACTTGAAAAACGAGGCCAAAGCCAAGGCAGAGGCTAAGGAGAAATATATCAATGACCTCGTACCC......AAATTTAGCACTGATGGAAAGGATGTAGCTGCACTCCAAGCTCTTTGTAAAGATTTTCACAAGAAGCTTGCATCA------CTCGAAGAAGATGTTTATGACTGGGAGGCAAAGATTCGCAAA
TRN  10010101100011001
//