EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00984 - UDPG_MGDP_dh)
FAM  PF00984
PID  UDPG_MGDP_dh
DES  UDP-glucose/GDP-mannose dehydrogenase family, central domain
IPR  IPR001732
ANO  27
ALN  100
AID  0.332155
APH  ((((((((((UDG_RICPR/197-292:0.37933,O31279_ACEXY/206-301:0.34496):0.15041,((O07248_MYCTU/203-300:0.48506,(O34862_BACSU/196-291:0.41085,Y1054_METJA/198-295:0.55637):0.09479):0.10807,((UGDH_DROME/209-306:0.04682,UGDH_CAEEL/220-317:0.16776):0.09304,UGDH_SOYBN/209-306:0.15987):0.46574):0.05102):0.02757,((P96718_BACSU/197-292:0.32465,TUAD_BACSU/198-293:0.11195):0.07410,(Q56812_XANCA/203-296:0.83615,P72834_SYNY3/219-314:0.02643):0.19147):0.07071):0.13702,((ALGD_PSEAE/203-300:0.07920,(ALGD_AZOVI/203-300:0.15893,ALGD_PSESH/203-300:0.02851):0.04008):0.67462,O29659_ARCFU/243-338:0.16448):0.15080):0.12924,Q54365_STRLN/196-291:1.19459):0.17540,UDG_STRPY/197-290:1.09598):0.76227,(O26924_METTH/203-298:0.15367,(((WECC_ECOLI/205-297:0.14832,EPSD2_RALSO/211-303:0.08153):0.22126,Y428_METJA/202-293:0.09228):0.06466,P72381_STAAU/197-289:0.21597):0.12069):0.23420):0.20829,P72132_PSEAE/211-307:0.51123):0.40115,Q55042_SHISO/202-295:0.14351):0.08587,CAPL_STAAU/196-290:0.11948,VIPA_SALTI/201-295:0.14212);
ATP  ((((((((((UDG_RICPR/197-292,O31279_ACEXY/206-301),((O07248_MYCTU/203-300,(O34862_BACSU/196-291,Y1054_METJA/198-295)),((UGDH_DROME/209-306,UGDH_CAEEL/220-317),UGDH_SOYBN/209-306))),((P96718_BACSU/197-292,TUAD_BACSU/198-293),(Q56812_XANCA/203-296,P72834_SYNY3/219-314))),((ALGD_PSEAE/203-300,(ALGD_AZOVI/203-300,ALGD_PSESH/203-300)),O29659_ARCFU/243-338)),Q54365_STRLN/196-291),UDG_STRPY/197-290),(O26924_METTH/203-298,(((WECC_ECOLI/205-297,EPSD2_RALSO/211-303),Y428_METJA/202-293),P72381_STAAU/197-289))),P72132_PSEAE/211-307),Q55042_SHISO/202-295),CAPL_STAAU/196-290,VIPA_SALTI/201-295);
ATL  12.9437
DNO  27
DLN  300
DID  0.443281
DPH  ((((((((P72834_SYNY3/219-314:0.29659,((UDG_RICPR/197-292:0.28651,Y1054_METJA/198-295:0.45445):0.09561,O34862_BACSU/196-291:0.39060):0.10335):0.07269,(((O07248_MYCTU/203-300:0.22835,((UGDH_DROME/209-306:0.18637,UGDH_CAEEL/220-317:0.29245):0.11340,UGDH_SOYBN/209-306:0.20971):0.30157):0.13061,((Q54365_STRLN/196-291:0.51051,Q56812_XANCA/203-296:0.45539):0.03959,((ALGD_PSESH/203-300:0.12513,ALGD_PSEAE/203-300:0.08432):0.03038,ALGD_AZOVI/203-300:0.04555):0.31991):0.16597):0.08610,O31279_ACEXY/206-301:0.30935):0.09973):0.08517,P96718_BACSU/197-292:0.26387):0.06867,(TUAD_BACSU/198-293:0.09400,UDG_STRPY/197-290:0.93396):0.11643):0.18190,O29659_ARCFU/243-338:0.20187):0.45301,(P72132_PSEAE/211-307:0.39428,((Y428_METJA/202-293:0.21972,(P72381_STAAU/197-289:0.19870,(WECC_ECOLI/205-297:0.18979,EPSD2_RALSO/211-303:0.17056):0.20589):0.10805):0.06171,O26924_METTH/203-298:0.34015):0.15800):0.08889):0.25391,Q55042_SHISO/202-295:0.20142):0.07939,CAPL_STAAU/196-290:0.19621,VIPA_SALTI/201-295:0.22915);
DTP  ((((((((P72834_SYNY3/219-314,((UDG_RICPR/197-292,Y1054_METJA/198-295),O34862_BACSU/196-291)),(((O07248_MYCTU/203-300,((UGDH_DROME/209-306,UGDH_CAEEL/220-317),UGDH_SOYBN/209-306)),((Q54365_STRLN/196-291,Q56812_XANCA/203-296),((ALGD_PSESH/203-300,ALGD_PSEAE/203-300),ALGD_AZOVI/203-300))),O31279_ACEXY/206-301)),P96718_BACSU/197-292),(TUAD_BACSU/198-293,UDG_STRPY/197-290)),O29659_ARCFU/243-338),(P72132_PSEAE/211-307,((Y428_METJA/202-293,(P72381_STAAU/197-289,(WECC_ECOLI/205-297,EPSD2_RALSO/211-303))),O26924_METTH/203-298))),Q55042_SHISO/202-295),CAPL_STAAU/196-290,VIPA_SALTI/201-295);
DTL  10.8181
RID  0.332155
RPH  ((((((((((UDG_RICPR/197-292:0.37933,O31279_ACEXY/206-301:0.34496):0.15041,((O07248_MYCTU/203-300:0.48506,(O34862_BACSU/196-291:0.41085,Y1054_METJA/198-295:0.55637):0.09479):0.10807,((UGDH_DROME/209-306:0.04682,UGDH_CAEEL/220-317:0.16776):0.09304,UGDH_SOYBN/209-306:0.15987):0.46574):0.05102):0.02757,((P96718_BACSU/197-292:0.32465,TUAD_BACSU/198-293:0.11195):0.07410,(Q56812_XANCA/203-296:0.83615,P72834_SYNY3/219-314:0.02643):0.19147):0.07071):0.13702,((ALGD_PSEAE/203-300:0.07920,(ALGD_AZOVI/203-300:0.15893,ALGD_PSESH/203-300:0.02851):0.04008):0.67462,O29659_ARCFU/243-338:0.16448):0.15080):0.12924,Q54365_STRLN/196-291:1.19459):0.17540,UDG_STRPY/197-290:1.09598):0.76227,(O26924_METTH/203-298:0.15367,(((WECC_ECOLI/205-297:0.14832,EPSD2_RALSO/211-303:0.08153):0.22126,Y428_METJA/202-293:0.09228):0.06466,P72381_STAAU/197-289:0.21597):0.12069):0.23420):0.20829,P72132_PSEAE/211-307:0.51123):0.40115,Q55042_SHISO/202-295:0.14351):0.08587,CAPL_STAAU/196-290:0.11948,VIPA_SALTI/201-295:0.14212);
RTP  ((((((((((UDG_RICPR/197-292,O31279_ACEXY/206-301),((O07248_MYCTU/203-300,(O34862_BACSU/196-291,Y1054_METJA/198-295)),((UGDH_DROME/209-306,UGDH_CAEEL/220-317),UGDH_SOYBN/209-306))),((P96718_BACSU/197-292,TUAD_BACSU/198-293),(Q56812_XANCA/203-296,P72834_SYNY3/219-314))),((ALGD_PSEAE/203-300,(ALGD_AZOVI/203-300,ALGD_PSESH/203-300)),O29659_ARCFU/243-338)),Q54365_STRLN/196-291),UDG_STRPY/197-290),(O26924_METTH/203-298,(((WECC_ECOLI/205-297,EPSD2_RALSO/211-303),Y428_METJA/202-293),P72381_STAAU/197-289))),P72132_PSEAE/211-307),Q55042_SHISO/202-295),CAPL_STAAU/196-290,VIPA_SALTI/201-295);
RTL  12.9437
LNK  ALGD_AZOVI/203-300:P51585:U11240
LNK  ALGD_PSEAE/203-300:P11759:Y00337
LNK  ALGD_PSESH/203-300:O07299:AF001555
LNK  CAPL_STAAU/196-290:P39861:U10927
LNK  EPSD2_RALSO/211-303:Q45410:U17898
LNK  O07248_MYCTU/203-300:O07248:BX842573
LNK  O26924_METTH/203-298:O26924:AE000860
LNK  O29659_ARCFU/243-338:O29659:AE001064
LNK  O31279_ACEXY/206-301:O31279:Y11203
LNK  O34862_BACSU/196-291:O34862:AF008220
LNK  P72132_PSEAE/211-307:P72132:AE004739
LNK  P72381_STAAU/197-289:P72381:U73374
LNK  P72834_SYNY3/219-314:P72834:BA000022
LNK  P96718_BACSU/197-292:P96718:Z92952
LNK  Q54365_STRLN/196-291:Q54365:X79146
LNK  Q55042_SHISO/202-295:Q55042:U34305
LNK  Q56812_XANCA/203-296:Q56812:X79772
LNK  TUAD_BACSU/198-293:O32271:AF015609
LNK  UDG_RICPR/197-292:O05973:Y11785
LNK  UDG_STRPY/197-290:Q07172:L08444
LNK  UGDH_CAEEL/220-317:Q19905:AY147932
LNK  UGDH_DROME/209-306:O02373:AF007870
LNK  UGDH_SOYBN/209-306:Q96558:U53418
LNK  VIPA_SALTI/201-295:Q04972:X67785
LNK  WECC_ECOLI/205-297:P27829:U00096
LNK  Y1054_METJA/198-295:Q58454:U67548
LNK  Y428_METJA/202-293:Q57871:U67494
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y428_METJA/202-293
ASQ  AKTAEMVKLMENTYRDVNIALANEFAKIAEEIGINVWEAIELANKHPRVN-.--ILKPGPGVGGHCISIDPWFIVEKS----KNAKLIRTARELNDSMPL
DSQ  GCTAAAACAGCAGAGATGGTTAAGTTAATGGAAAATACTTATAGAGATGTTAATATTGCCTTAGCCAACGAATTTGCAAAAATTGCAGAGGAAATTGGCATTAATGTTTGGGAAGCAATAGAATTAGCCAATAAACATCCAAGAGTAAAT---...------ATTTTAAAGCCAGGGCCAGGAGTAGGTGGGCATTGTATAAGCATAGACCCGTGGTTTATTGTTGAGAAATCA------------AAGAACGCTAAATTAATAAGAACTGCAAGAGAGTTAAACGACTCTATGCCATTA
TRN  10010101110011000
NAM  O26924_METTH/203-298
ASQ  LMTAEMVKLMENTYRDTNIALANELAVICEALGIDAINAIEAANHHPRVN-.--IHTPGPGVGGHCLSIDPYFIVEMAERKGVPARLIRTAREVNESMPL
DSQ  CTCATGACAGCCGAGATGGTTAAACTGATGGAGAACACCTACAGGGACACCAACATAGCCCTTGCCAATGAGCTTGCGGTTATATGTGAGGCCCTTGGCATAGACGCCATAAACGCCATCGAGGCAGCAAACCACCATCCGAGGGTGAAC---...------ATACACACACCGGGTCCGGGTGTTGGCGGCCACTGCCTCTCAATAGACCCCTACTTCATAGTGGAGATGGCGGAGAGGAAGGGCGTGCCTGCAAGGCTAATAAGGACGGCCAGGGAGGTAAATGAGTCCATGCCCCTG
TRN  10010101100011001
NAM  P72381_STAAU/197-289
ASQ  ARTAEMSKLMENTYRDVNIALANELTKICNNLNINVLVVIEMANKHPRVN-.--IHQPGPGVGGHCLAVDPYFIIAKDP---ENAKLIQTGREINNSMPA
DSQ  GCACGTACTGCTGAAATGAGTAAGCTAATGGAAAACACATATAGAGACGTGAATATTGCTTTAGCTAATGAATTAACAAAAATTTGCAATAACTTAAATATTAATGTATTAGTTGTGATTGAAATGGCAAACAAACATCCGCGTGTTAAT---...------ATCCATCAACCTGGTCCAGGAGTAGGCGGTCATTGTTTAGCTGTTGATCCGTACTTTATTATTGCTAAAGACCCT---------GAAAATGCAAAGTTAATTCAAACTGGACGTGAAATTAATAATTCAATGCCGGCC
TRN  10010101110011000
NAM  EPSD2_RALSO/211-303
ASQ  ARTAEMCKLTENAFRDVNIAFANELSMICDEIGVNVWELISVANRHPRVN-.--ILQPGPGVGGHCIAVDPWFIVDAAP---ESARLIRTAREVNDAKPH
DSQ  GCGCGCACGGCCGAGATGTGCAAGCTGACGGAGAACGCTTTCCGCGACGTCAACATTGCGTTCGCCAATGAGCTGTCGATGATCTGCGATGAAATCGGCGTCAACGTGTGGGAGCTGATCAGCGTGGCGAACCGCCATCCGCGGGTCAAC---...------ATCCTGCAGCCGGGGCCCGGCGTGGGCGGGCATTGCATCGCCGTCGATCCCTGGTTCATCGTCGATGCGGCACCC---------GAGAGCGCGCGCCTGATCCGCACCGCGCGCGAGGTCAACGATGCCAAGCCGCAC
TRN  11011111101111111
NAM  WECC_ECOLI/205-297
ASQ  SRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHPRVN-.--ILQPGPGVGGHCIAVDPWFIVAQNP---QQARLIRTAREVNDHKPF
DSQ  TCGCGGACGGCGGAAATGTGTAAGCTCACCGAAAACAGCTTCCGCGATGTGAATATCGCTTTTGCTAATGAATTGTCGCTGATTTGTGCCGATCAGGGGATTAACGTCTGGGAACTGATTCGCCTGGCGAATCGTCACCCTCGCGTTAAT---...------ATTCTTCAGCCTGGCCCTGGCGTGGGCGGTCACTGCATTGCTGTTGATCCGTGGTTTATCGTGGCACAGAACCCC---------CAGCAGGCGCGGCTTATCCGTACCGCGCGCGAAGTGAACGATCACAAACCGTTC
TRN  11011101101011011
NAM  VIPA_SALTI/201-295
ASQ  IKVAEAAKVIENTQRDLNIALVNELAIIFNRLNIDTEAVLRAAGSKWNFL-.--PFRPG-LVGGHCIGVDPYYLTHKSQGIGYYPEIILAGRRLNDNMGN
DSQ  ATCAAAGTTGCTGAGGCAGCGAAGGTGATTGAAAATACGCAACGCGATCTGAATATTGCCTTGGTCAATGAGCTGGCGATTATTTTTAATCGTTTAAATATCGATACTGAAGCCGTGCTACGTGCCGCTGGCAGCAAATGGAATTTCCTG---...------CCATTCCGTCCGGGA---CTGGTCGGTGGTCACTGTATTGGCGTAGATCCCTATTATCTGACACATAAATCTCAGGGCATTGGCTATTATCCAGAAATCATACTTGCAGGACGCCGCCTGAACGACAACATGGGCAAC
TRN  10010101100011010
NAM  CAPL_STAAU/196-290
ASQ  IKVAEAAKVIENTQRDVNIALMNELAIIFDKLDIDTNEVLKASGTKWNFL-.--NFKPG-LVGGHCIGVDPYYLTHKAQEVGHHPEVILAGRRINDNMAK
DSQ  ATTAAAGTAGCAGAAGCAGCAAAAGTCATTGAAAACACACAACGTGATGTAAATATTGCCCTAATGAATGAATTGGCAATTATTTTTGATAAATTAGATATAGATACTAACGAGGTATTAAAAGCTTCAGGAACAAAATGGAACTTCTTG---...------AATTTTAAACCAGGA---TTAGTAGGGGGACATTGCATTGGTGTGGACCCATATTATTTAACACATAAAGCTCAGGAAGTTGGGCACCATCCTGAAGTGATTTTAGCAGGTAGAAGAATAAATGATAATATGGCTAAA
TRN  10010101110011000
NAM  Q55042_SHISO/202-295
ASQ  IKVERLQSNVN-TQRDVNIALINELSIIFNKLGIDTLEVLEAAGTKWNLL-.--PFRPG-LVGGHCIGVDPYYLTHKAQSVGYHPEMILAGRRLNDSMGQ
DSQ  ATAAAAGTAGAGAGGCTGCAAAGTAATGTAAAC---ACGCAGCGAGATGTCAATATTGCATTGATTAATGAGTTATCTATTATATTTAATAAGTTAGGGATTGATACCTTAGAGGTTCTTGAGGCTGCAGGTACGAAGTGGAATCTTTTA---...------CCTTTTAGGCCCGGT---TTAGTAGGTGGCCACTGTATAGGTGTAGATCCTTATTATCTTACACATAAAGCGCAAAGTGTCGGCTATCATCCGGAGATGATTTTAGCCGGACGTCGTTTAAATGATAGTATGGGGCAG
TRN  10010101100011010
NAM  P72132_PSEAE/211-307
ASQ  TKAAEMTKLLENIHRAVNIGLVNEMKIVADRMGIDIFEVVDAAATKPFGF-.-TPYYPGPGLGGHCIPIDPFYLTWKAREYGLHTRFIELSGEVNQAMPE
DSQ  ACCAAGGCCGCCGAGATGACCAAGCTGTTGGAGAACATTCATCGCGCGGTCAATATCGGTCTGGTCAACGAAATGAAGATCGTTGCTGATCGCATGGGTATCGACATCTTTGAAGTGGTTGATGCTGCGGCGACCAAGCCGTTCGGTTTC---...---ACTCCTTACTACCCAGGGCCGGGACTGGGCGGGCACTGTATCCCGATCGATCCCTTCTACCTGACTTGGAAGGCTCGCGAATACGGACTGCATACCCGCTTCATCGAACTGTCTGGTGAGGTCAACCAGGCCATGCCGGAA
TRN  11011111101111111
NAM  UGDH_SOYBN/209-306
ASQ  LWSAELSKLAANAFLAQRISSVNAMSALCEATGANVQQVSYSVGTDSRIG-.PKFLNASVGFGGSCFQKDILNLVYICECNGLPEVAEYWKQVIKINDYQ
DSQ  CTTTGGTCGGCAGAACTGTCTAAGCTTGCTGCTAATGCCTTCTTAGCACAAAGGATTTCATCTGTCAATGCCATGTCAGCACTTTGTGAGGCTACTGGGGCAAACGTTCAACAGGTGTCCTATTCTGTTGGTACAGACTCAAGGATTGGA---...CCCAAGTTTCTCAATGCCAGTGTTGGTTTTGGTGGATCCTGCTTCCAGAAGGATATCTTGAACCTTGTTTACATCTGTGAGTGCAATGGCCTTCCAGAGGTGGCTGAGTATTGGAAACAAGTGATCAAGATCAATGATTATCAG
TRN  10010101100011000
NAM  UGDH_CAEEL/220-317
ASQ  TWSSELSKLVANAFLAQRISSINSISAVCEATGAEISEVAHAVGYDTRIG-.SKFLQASVGFGGSCFQKDVLSLVYLCESLNLPQVADYWQGVININNWQ
DSQ  ACATGGAGCAGCGAACTTTCGAAACTCGTTGCCAACGCATTCTTGGCTCAAAGAATTTCATCGATCAATTCAATTTCTGCCGTTTGCGAAGCTACCGGAGCTGAAATCTCGGAAGTTGCTCACGCAGTTGGATATGACACTCGAATTGGT---...AGCAAGTTCCTACAAGCATCTGTTGGCTTTGGAGGGAGCTGCTTCCAAAAAGATGTACTCTCACTTGTATATCTTTGCGAATCTCTCAATCTTCCACAAGTCGCTGATTATTGGCAAGGAGTGATTAATATTAACAACTGGCAA
TRN  10010101110011001
NAM  UGDH_DROME/209-306
ASQ  TWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIG-.SKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQ
DSQ  ACGTGGAGCAGCGAGCTGTCTAAGCTGGCGGCCAACGCATTCCTCGCCCAGCGAATCTCCAGCATTAATTCGCTGTCGGCAGTGTGCGAGGCCACGGGCGCAGATGTTTCCGAGGTGGCGAGGGCCGTGGGTCTAGACTCTCGCATCGGT---...TCCAAGTTCCTGCAGGCGTCGGTGGGCTTCGGCGGCAGTTGCTTTCAGAAGGACATCCTCAATCTGATCTACATCTGCGAGAACCTCAATCTGCCCGAGGTGGCCGCCTACTGGCAGCAGGTGATCGACATGAATGAGTACCAG
TRN  10010101100011011
NAM  Y1054_METJA/198-295
ASQ  WETAELIKYASNAFLATKISFINELAKLSDKVKADIKTISYAMGLDPRIG-.NKFLNAGIGYGGSCFHPDEVLFIDRGRGLECITFKELFELEDKDNVKI
DSQ  TGGGAGACTGCAGAGTTAATAAAATATGCCTCTAACGCTTTCTTAGCAACAAAGATATCTTTTATAAATGAGTTGGCAAAATTATCGGATAAAGTTAAAGCTGATATAAAAACAATAAGCTATGCTATGGGTTTAGATCCAAGAATTGGG---...AATAAGTTTTTAAATGCTGGGATTGGTTATGGTGGGAGCTGTTTCCACCCAGATGAAGTTTTATTTATAGATAGAGGTAGAGGTTTAGAATGCATAACATTCAAAGAATTATTTGAATTAGAAGATAAAGATAATGTAAAGATT
TRN  10010101110011010
NAM  P96718_BACSU/197-292
ASQ  IRSAEMIKYASNAFLATKISFINEISNICEKVGADIEAVAYGMGQDKRIG-.SQFLKAGIGYGGSCFPKDTNALVQIAGNVEHDFE--LLKSVIKVNNNQ
DSQ  ATCAGAAGCGCCGAGATGATCAAATATGCCTCAAATGCTTTTCTGGCCACTAAGATCAGTTTTATAAACGAAATTTCGAATATATGTGAAAAGGTCGGCGCCGATATTGAAGCAGTCGCATACGGGATGGGACAGGATAAGCGGATCGGG---...AGCCAGTTTTTAAAAGCGGGCATAGGCTACGGCGGCTCTTGTTTTCCAAAGGACACAAACGCCCTCGTGCAAATTGCCGGCAATGTCGAGCATGATTTTGAA------CTGCTGAAATCCGTTATCAAAGTCAACAACAATCAG
TRN  10010101100011000
NAM  P72834_SYNY3/219-314
ASQ  LSSAEMIKYAANAFLATKISFINEVANICDRVGADVTQVAQGIGLDSRIG-.SKFLNAGIGWGGSCFPKDVSALIHTAKDYGYTTS--ILNAVVEVNQVQ
DSQ  CTTAGTTCGGCGGAAATGATTAAGTATGCGGCCAATGCTTTTTTGGCTACCAAAATTAGTTTTATTAACGAGGTGGCCAATATCTGTGACCGGGTAGGGGCGGATGTGACCCAGGTGGCCCAGGGCATTGGCTTGGATTCCCGTATCGGT---...AGTAAATTTCTTAATGCGGGCATTGGTTGGGGAGGTTCCTGTTTTCCGAAGGATGTGTCTGCGTTGATCCACACTGCGAAGGACTATGGTTACACCACTTCA------ATTTTGAATGCCGTAGTGGAGGTAAACCAGGTACAA
TRN  11011101111011001
NAM  TUAD_BACSU/198-293
ASQ  LESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADGVGLDSRIG-.RKFLKAGIGFGGSCFPKDTTALLQIAKSAGYPFK--LIEAVIETNEKQ
DSQ  CTAGAAAGTGCAGAAATGATTAAATACGCCGCGAATGCATTTCTGGCGACAAAGATTTCCTTTATCAACGATATCGCAAACATTTGTGAGCGAGTCGGCGCAGACGTTTCAAAAGTTGCTGATGGTGTTGGTCTTGACAGCCGTATCGGC---...AGAAAGTTCCTTAAAGCTGGTATTGGATTCGGCGGTTCATGTTTTCCAAAGGATACAACCGCGCTGCTTCAAATCGCAAAATCGGCAGGCTATCCATTCAAG------CTCATCGAAGCTGTCATTGAAACGAACGAAAAGCAG
TRN  10010101100011001
NAM  O29659_ARCFU/243-338
ASQ  IKTAEMIKYASNAFLATKISFANEIGNICKKLRIDVYKVFEGVGLDHRIN-.PSFFRAGIGFGGSCFPKDVRALIRKSEELGENPK--ILKAVMEVNERQ
DSQ  ATAAAAACCGCTGAAATGATAAAATACGCATCGAACGCTTTTTTAGCTACGAAGATAAGCTTCGCCAACGAGATAGGAAACATATGCAAGAAGCTTAGGATTGATGTTTACAAGGTGTTTGAGGGTGTTGGTTTGGACCACAGAATAAAT---...CCATCATTTTTCAGAGCTGGGATTGGATTCGGGGGGAGCTGTTTTCCTAAGGATGTTAGAGCTTTGATTAGGAAGTCTGAAGAACTCGGCGAGAATCCGAAG------ATACTGAAAGCTGTTATGGAAGTAAATGAGAGACAG
TRN  10010101100011000
NAM  O34862_BACSU/196-291
ASQ  LAGAELIKYANNFFLAAKISFINEMARICEAYQSDISDISRAIGLDPRIG-.KHFLQAGIGYGGSCFPKDLQALQFAAQEKNTETF--LLRAVQHINDTQ
DSQ  TTAGCGGGAGCAGAGCTGATCAAATATGCCAACAATTTCTTTTTAGCGGCCAAAATTTCGTTCATTAACGAAATGGCCCGCATATGTGAAGCCTATCAATCAGATATCTCAGATATTTCCCGCGCTATCGGTCTAGACCCAAGGATCGGG---...AAGCACTTTTTGCAGGCAGGCATCGGATACGGAGGCTCTTGTTTTCCAAAGGATCTGCAGGCGCTGCAATTTGCTGCCCAGGAAAAAAACACGGAGACCTTC------CTGCTCCGGGCCGTGCAGCACATTAATGACACCCAG
TRN  10010101100011000
NAM  O31279_ACEXY/206-301
ASQ  LETAELIKYSANSFLAMKITFINEISDLCEKVGANVNDVARSIGLDGRIG-.KKFLHPSPGFGGSCFPKDTRALTAIGRNAGSPVR--LIETTVAVNEQR
DSQ  CTGGAAACGGCGGAACTGATCAAATATTCCGCCAATTCATTCCTCGCGATGAAAATTACCTTCATCAATGAAATCTCGGACCTGTGTGAAAAGGTTGGCGCCAATGTGAATGACGTGGCGCGTTCCATCGGGCTGGATGGACGTATTGGC---...AAGAAATTCCTGCATCCCAGCCCCGGCTTTGGTGGTTCGTGCTTTCCCAAGGATACCCGCGCACTGACGGCAATTGGCCGCAATGCGGGATCCCCCGTGCGC------CTGATCGAGACCACGGTCGCGGTCAACGAACAGCGC
TRN  11011101101011001
NAM  UDG_RICPR/197-292
ASQ  LVTSELIKYVSNSFLATKIAFINEMADLCEKIGANIKDLSQGVGLDQRIG-.RNFLNAGPGFGGSCFPKDILALNNLVENHKIDCK--ILKSVIKSNKLR
DSQ  TTAGTAACGAGTGAGCTTATTAAATATGTTTCAAATAGTTTTTTAGCAACGAAAATTGCTTTTATTAATGAAATGGCTGATTTATGCGAAAAAATCGGCGCTAACATTAAAGATTTATCTCAAGGTGTAGGACTTGATCAAAGAATCGGT---...CGAAATTTTTTAAATGCAGGACCTGGTTTTGGTGGTTCGTGTTTCCCAAAAGATATTCTGGCATTAAATAATCTTGTTGAAAATCATAAGATCGATTGTAAG------ATTCTTAAGTCAGTAATAAAGAGTAATAAGCTGCGG
TRN  10010101100011000
NAM  O07248_MYCTU/203-300
ASQ  LQTAELVKVSANAFLATKISFINAISEVCEAAGADVSQLADALGYDPRIG-.RQCLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRR
DSQ  CTGCAGACCGCGGAGTTGGTCAAGGTATCCGCCAATGCCTTTCTGGCGACCAAGATTTCGTTTATCAATGCGATCTCCGAAGTGTGCGAGGCGGCGGGTGCCGACGTTAGCCAGCTGGCCGATGCGCTCGGATACGACCCGCGGATCGGA---...CGCCAATGCCTCAACGCGGGCTTGGGTTTCGGCGGCGGCTGCTTGCCCAAGGACATCCGCGCTTTCATGGCCCGCGCCGGCGAACTGGGAGCCGACCAGGCGTTGACGTTCCTGCGTGAAGTGGACAGCATCAACATGCGCCGG
TRN  11011111101111111
NAM  Q56812_XANCA/203-296
ASQ  VRSAELTKYAANAMLATKISFMNEIANIAERVGADVEHVRNGIGSDPRIG-.--WHFIYPVPATARASRRCAGARKTAHEYGMQPT--LLNAVESVNNAQ
DSQ  GTGCGCTCGGCCGAGCTGACCAAGTACGCGGCCAACGCGATGCTGGCGACCAAGATCAGTTTCATGAACGAGATCGCCAACATTGCCGAACGCGTCGGTGCGGACGTCGAGCATGTGCGTAACGGCATTGGTTCGGATCCGCGCATTGGC---...------TGGCACTTCATCTATCCGGTGCCGGCTACGGCTCGTGCTTCCCGAAGATGTGCAGGCGCTCGCAAGACCGCGCACGAGTACGGCATGCAGCCGACC------CTGCTCAACGCGGTGGAAAGCGTCAACAACGCGCAG
TRN  10010101100011011
NAM  ALGD_PSESH/203-300
ASQ  IAVAEMIKYTCNVWHATKVTFANEIGNIAKAVGVDGREVMDVVCQDKALNLsQYYMRPGFAFGGSCLPKDVRALTYRASSLDVEAP--LLNSLMRSNTSQ
DSQ  ATCGCCGTTGCCGAAATGATCAAGTACACCTGCAACGTGTGGCACGCCACCAAGGTTACTTTCGCCAACGAAATCGGCAACATTGCCAAGGCCGTCGGCGTCGATGGTCGTGAAGTGATGGACGTGGTCTGCCAGGACAAGGCGCTGAACCTGtccCAGTACTACATGCGCCCAGGGTTCGCATTCGGCGGCTCCTGCCTGCCAAAAGACGTTCGCGCCCTGACCTACCGCGCCAGCAGCCTGGATGTCGAAGCGCCG------TTGCTCAACTCGCTGATGCGCAGCAACACCTCGCAA
TRN  11011101101011011
NAM  ALGD_PSEAE/203-300
ASQ  VEVAEMIKYTCNVWHAAKVTFANEIGNIAKAVGVDGREVMDVICQDHKLNLsRYYMRPGFAFGGSCLPKDVRALTYRASQLDVEHP--MLGSLMRSNSNQ
DSQ  GTCGAGGTCGCCGAGATGATCAAGTACACCTGCAACGTCTGGCACGCCGCCAAGGTCACCTTCGCCAACGAGATCGGCAACATCGCCAAGGCGGTCGGCGTCGACGGCCGCGAGGTGATGGACGTGATCTGCCAGGACCACAAGCTCAACCTGtcgCGCTACTACATGCGTCCCGGCTTCGCCTTCGGCGGCTCCTGCCTGCCCAAGGATGTACGCGCCCTCACCTATCGCGCCAGCCAGCTGGACGTCGAGCACCCG------ATGCTCGGTTCGTTGATGCGCAGCAACTCCAACCAG
TRN  11011111101111111
NAM  ALGD_AZOVI/203-300
ASQ  IAVAEMIKYTCNVWHATKVTFANEIGNIAKAAGVDGREVMEVVCMDNKLNLsQYYMRPGLAFGGSCLPKDVSALSYRAHLWDIEAP--LISSLMRSNAAQ
DSQ  ATCGCCGTCGCCGAGATGATCAAGTACACCTGCAACGTCTGGCACGCGACCAAGGTCACCTTCGCCAACGAGATCGGCAACATCGCCAAGGCCGCCGGCGTCGATGGCCGCGAGGTGATGGAAGTGGTCTGCATGGACAACAAGCTCAACCTGtccCAGTACTACATGCGGCCCGGCTTGGCGTTCGGCGGTTCCTGCCTGCCCAAGGACGTCAGCGCCCTCAGCTACCGTGCCCACCTGTGGGACATCGAGGCGCCG------CTGATCAGTTCGCTGATGCGCAGCAACGCCGCCCAG
TRN  11011111101111111
NAM  UDG_STRPY/197-290
ASQ  ASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDRIG-.MHYNNPSFGYGGYCLPKDTK--QLLANYNNIPQT--LIEAIVSSNNVR
DSQ  GCTTCAGAAGCTGAAGCAGTAAAACTATTTGCCAATACTTATTTAGCGTTAAGGGTAGCTTATTTTAATGAGTTAGACACTTACGCAGAATCGAGAAAATTAAATAGTCACATGATTATTCAAGGAATTTCTTATGATGATCGAATAGGA---...ATGCATTATAATAACCCATCATTTGGTTATGGAGGTTATTGTCTACCTAAAGATACGAAG------CAATTATTGGCAAATTACAATAATATTCCCCAAACA------CTAATTGAAGCTATCGTTTCATCAAATAATGTGCGC
TRN  10010101110011000
NAM  Q54365_STRLN/196-291
ASQ  LTEAELVKHATNAYLGMCVSFGNELGWLAAHLGADPQVVARLLKADPRVAD.AAPLLPGAAFSGATLRRDLVALSRIGAKWGRPEF---FDTVLTVNDRH
DSQ  CTCACCGAGGCCGAGCTCGTCAAGCACGCCACCAACGCCTACCTGGGCATGTGCGTGTCCTTCGGCAACGAGCTCGGCTGGCTCGCCGCCCACCTGGGCGCCGACCCTCAGGTGGTGGCGCGGCTCCTGAAGGCCGACCCGAGGGTGGCCGAC...GCGGCGCCCCTGCTGCCCGGCGCGGCGTTCTCCGGGGCCACCCTGCGCCGTGACCTGGTGGCGCTCAGCCGGATCGGCGCGAAGTGGGGCCGGCCGGAGTTC---------TTCGACACCGTTCTCACCGTCAACGACCGGCAC
TRN  10010101100011011
//