EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00983 - Tymo_coat)
FAM  PF00983
PID  Tymo_coat
DES  Tymovirus coat protein
IPR  IPR000574
ANO  9
ALN  176
AID  0.427667
APH  (((((O09737_9VIRU/7-178:0.15191,((COAT_CAYMV/7-177:0.30983,COAT_TYMV/7-178:0.67738):0.03586,COAT_KYMVJ/7-178:0.14398):0.13582):0.28190,COAT_ELV/19-190:0.76708):0.26908,Q65665_BMDV/8-179:0.40271):0.07991,COAT_OYMV/8-179:0.58166):0.11312,COAT_BMDV/8-181:0.22292,COAT_EPMV/8-179:0.37410);
ATP  (((((O09737_9VIRU/7-178,((COAT_CAYMV/7-177,COAT_TYMV/7-178),COAT_KYMVJ/7-178)),COAT_ELV/19-190),Q65665_BMDV/8-179),COAT_OYMV/8-179),COAT_BMDV/8-181,COAT_EPMV/8-179);
ATL  4.51281
DNO  7
DLN  528
DID  0.52881
DPH  (O09737_9VIRU/7-178:0.28357,COAT_KYMVJ/7-178:0.16864,((COAT_TYMV/7-178:0.37749,((COAT_OYMV/8-179:0.43130,Q65665_BMDV/8-179:0.28854):0.10278,COAT_EPMV/8-179:0.30316):0.29222):0.11341,COAT_CAYMV/7-177:0.20142):0.09738);
DTP  (O09737_9VIRU/7-178,COAT_KYMVJ/7-178,((COAT_TYMV/7-178,((COAT_OYMV/8-179,Q65665_BMDV/8-179),COAT_EPMV/8-179)),COAT_CAYMV/7-177));
DTL  2.65991
RID  0.439006
RPH  (((((O09737_9VIRU/7-178:0.26600,COAT_KYMVJ/7-178:0.15115):0.04083,COAT_TYMV/7-178:0.67267):0.13018,COAT_CAYMV/7-177:0.19145):0.50260,COAT_EPMV/8-179:0.36031):0.12556,COAT_OYMV/8-179:0.51943,Q65665_BMDV/8-179:0.45174);
RTP  (((((O09737_9VIRU/7-178,COAT_KYMVJ/7-178),COAT_TYMV/7-178),COAT_CAYMV/7-177),COAT_EPMV/8-179),COAT_OYMV/8-179,Q65665_BMDV/8-179);
RTL  3.4318
LNK  COAT_BMDV/8-181:P15158:
LNK  COAT_CAYMV/7-177:P19128:X54354
LNK  COAT_ELV/19-190:P35927:
LNK  COAT_EPMV/8-179:P20123:J04374
LNK  COAT_KYMVJ/7-178:P36303:D00637
LNK  COAT_OYMV/8-179:P20124:J04375
LNK  COAT_TYMV/7-178:P03608:V01418
LNK  O09737_9VIRU/7-178:O09737:U91413
LNK  Q65665_BMDV/8-179:Q65665:X54529
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q65665_BMDV/8-179
ASQ  TVKQPSISAPGFTLSAPDGEQAGSIRQIFQFEATSVGVYETLAQVNLSSSDSLAKLTSGYRRAKVVELFLTITPTQRAIDCPVTVDVAWVPANSTAPPSKILS--IYGGQRFLIGGPITTSQIIRVPCNLQSVNAMIKDSTIYTDSPKLLVYAPIAKGSP--KTPSATVQIGGQIL
DSQ  ACCGTCAAGCAACCCAGCATCTCTGCTCCCGGCTTTACTCTTTCAGCCCCTGATGGAGAACAGGCCGGCTCCATCCGCCAGATCTTCCAGTTCGAAGCCACTTCTGTCGGCGTCTATGAGACACTGGCCCAGGTCAACCTCTCCTCCTCTGACTCCCTGGCCAAACTCACCTCTGGGTATCGACGTGCCAAAGTCGTCGAACTCTTCCTCACCATCACTCCCACGCAAAGAGCCATCGACTGCCCCGTCACTGTCGACGTGGCATGGGTCCCGGCTAATTCCACAGCTCCACCCTCCAAAATTCTCTCC------ATCTATGGCGGCCAACGATTTTTAATCGGAGGTCCCATCACCACTTCTCAGATCATTCGTGTTCCCTGCAATCTGCAATCTGTGAACGCCATGATCAAAGACTCCACCATTTACACCGACTCCCCCAAGCTTCTGGTTTATGCTCCAATTGCCAAAGGAAGTCCC------AAAACACCCTCTGCCACTGTCCAAATCGGTGGTCAGATCCTC
TRN  10010101100011000
NAM  COAT_EPMV/8-179
ASQ  RSPQPSINAPGFHLPPTDSQQSSAIELPFQFQATTFGATETAAQISLASANAITKLASLYRHVRLTQCAATITPTAAAIANPLTVNIVWVSDNSTAKPTEILN--VFGGSSYTFGGALNATKPLTIPLPMNSVNCMLKDSVLYTDCPKLLAYSAAPSSPS--KTPTATIQIHGKLR
DSQ  AGAAGCCCTCAGCCCTCCATAAACGCACCAGGCTTCCATCTGCCACCCACCGACTCACAACAATCCTCTGCTATTGAACTCCCCTTCCAGTTTCAGGCCACCACTTTTGGCGCGACTGAAACAGCTGCTCAAATCAGTCTGGCCTCCGCCAACGCTATTACCAAGCTCGCGTCTCTCTACCGCCATGTGCGGCTCACGCAGTGCGCTGCCACCATCACTCCGACAGCGGCCGCCATTGCCAATCCTCTCACTGTCAACATCGTCTGGGTGTCTGACAATTCCACTGCCAAGCCCACCGAGATTCTCAAT------GTCTTTGGTGGATCTTCCTACACGTTTGGCGGCGCCCTCAATGCCACCAAGCCCCTTACCATCCCTCTCCCCATGAACTCGGTCAACTGTATGCTCAAGGACTCTGTTCTTTACACAGATTGCCCAAAGCTCCTGGCCTACTCAGCTGCTCCCAGCTCTCCCTCC------AAAACCCCAACCGCCACTATCCAAATCCATGGCAAGCTCCGC
TRN  10010101100011001
NAM  COAT_BMDV/8-181
ASQ  KVKQASIPAPGSILSQPNTEQSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILKLRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPS--KIPTASIQISGRIR
NAM  COAT_OYMV/8-179
ASQ  KVRQPSISAPGTHLSPNPGQQSPSMVVPFQVSVSDLGVSEVSAQITLSSDPTLAQLTSIYRMASIVECEAVLFPNSTSSKNPVHCDLIWVPSNSSASPKTILQ--TYGGNRFTVGGPITSNQIISFPLRLDSVNPIIKDSVLYLDSPRLLAFSPAPPETQ--SIPSASLLIRGKLR
DSQ  AAAGTGCGCCAACCCTCCATCTCTGCTCCTGGGACTCATCTGTCTCCAAACCCAGGACAACAATCCCCTAGCATGGTCGTTCCTTTCCAAGTTTCTGTTTCAGACCTTGGTGTTTCTGAGGTCTCTGCTCAGATCACCCTTTCCTCCGATCCAACCCTTGCTCAACTCACTTCCATTTATCGCATGGCCTCCATCGTTGAATGCGAAGCGGTTCTCTTTCCTAACTCCACCTCTTCTAAGAATCCCGTTCACTGCGATCTTATTTGGGTCCCTTCAAACTCTTCCGCTTCACCCAAAACCATCCTTCAA------ACCTATGGCGGCAACCGATTTACAGTCGGCGGTCCCATAACTTCCAACCAAATCATTTCTTTTCCTCTCCGTCTTGATTCTGTCAATCCCATCATCAAAGATAGCGTCCTGTACCTTGATTCTCCAAGGCTTCTCGCTTTCTCTCCTGCTCCCCCTGAGACTCAA------TCCATTCCATCTGCTTCTCTCCTCATTCGCGGAAAGCTTCGA
TRN  10010101100011001
NAM  O09737_9VIRU/7-178
ASQ  TSIQPAINTKSSDLPLQSGQHPPSVLQPFQITVASLGTKDLSDSISVAALSSIASYTTLYRHAKLTSLTATIHPNALSVSNPTTVSLVWVPYNSSATSAQILD--VYGAKRFCIGGAINTLSSIHVPCNLTNVNPIIKDSVTYTDTPKLLLSSTTIASPP--TSPTCTVTISGTIT
DSQ  ACCTCCATTCAGCCTGCCATCAACACCAAATCGTCTGACCTCCCCCTCCAGTCCGGCCAGCATCCACCCTCTGTCCTTCAACCTTTCCAAATCACTGTTGCTTCCCTCGGAACCAAGGATCTCTCCGACAGCATCAGTGTCGCTGCCCTTTCCTCTATCGCCTCCTACACTACCCTGTACAGGCATGCCAAGCTAACCTCCCTCACAGCCACAATCCATCCCAATGCTCTCAGCGTTTCAAACCCCACCACCGTTTCCCTAGTCTGGGTGCCCTACAATTCATCCGCCACCAGTGCCCAGATCCTTGAT------GTTTATGGCGCCAAACGGTTCTGCATCGGTGGAGCCATAAACACTCTCTCCTCAATCCATGTACCTTGCAACCTAACCAATGTCAACCCCATCATCAAGGACTCGGTGACCTACACCGACACTCCAAAATTGCTTCTCTCTTCCACCACTATCGCCAGCCCTCCC------ACCTCCCCCACTTGTACCGTCACCATTTCCGGTACCATCACT
TRN  10010101100011001
NAM  COAT_KYMVJ/7-178
ASQ  LASQLPVNTKSSEIPLQSGTPPPTIIYPFQIEMASLGTADASDSISIASNSLLASVTTLYRHAKLTSLKATIHPTGQAPAFPTTVALAWVPYNSTATSAQILS--VYGGQMFCIGGSINSLSPIDVPCNLTNVNPIIKDSVTYSDTPKLLLYSIAQETAP--TLATCSVTITGTLT
DSQ  CTCGCTTCCCAACTCCCAGTGAACACCAAGTCCTCTGAAATTCCTCTTCAGAGTGGCACTCCACCCCCCACAATAATCTACCCTTTCCAAATCGAGATGGCCAGCCTTGGCACGGCCGATGCTTCTGATTCCATCAGCATCGCCTCCAACTCTCTCCTCGCCTCCGTAACCACCTTGTACCGGCATGCCAAATTGACCTCCCTCAAAGCTACCATCCACCCAACCGGCCAAGCCCCAGCCTTCCCAACCACCGTTGCCCTGGCCTGGGTTCCCTACAACTCCACCGCCACCTCTGCTCAGATTCTCTCC------GTCTACGGCGGCCAGATGTTCTGCATCGGCGGCTCCATCAACTCTCTCTCCCCAATCGACGTTCCCTGTAACCTCACCAACGTCAACCCCATCATCAAAGACTCAGTCACTTACTCTGACACCCCCAAGCTCCTCCTCTATTCCATCGCCCAGGAGACAGCTCCC------ACCCTCGCTACCTGTTCCGTAACCATCACCGGAACCCTCACT
TRN  10010101100011001
NAM  COAT_CAYMV/7-177
ASQ  LAPQPLINTKASELPSQSGSPPPEIVYPFQFTIASLGVEPTADFVSIAAQAAITAYTSLYRHAILTDLQAIIHPNGYAPAFPTSVALAWVPYNSTATAAKILD--VFGGQEFCVGGSINSTSPIIVPCPLTNINPIIKDSVTYTDTPKLLIYSTAPSYS---TSATCTLTIRGKVR
DSQ  CTCGCTCCCCAGCCCCTCATCAACACTAAAGCATCCGAACTTCCCTCACAATCCGGTTCTCCTCCCCCTGAAATTGTCTACCCCTTCCAGTTTACCATCGCTTCCCTCGGCGTTGAACCCACCGCCGACTTCGTCAGCATTGCGGCCCAGGCCGCCATCACCGCCTACACCTCCCTCTACCGCCACGCCATTCTCACTGACCTCCAGGCCATCATTCACCCCAATGGCTACGCCCCCGCCTTCCCAACCTCCGTGGCCCTCGCGTGGGTCCCCTATAATTCCACCGCCACCGCCGCCAAAATCCTTGAC------GTCTTCGGAGGTCAAGAATTTTGCGTCGGGGGTTCCATCAACTCCACTTCCCCCATCATCGTCCCCTGCCCCCTCACCAACATCAACCCCATCATCAAAGATTCCGTCACCTACACTGACACCCCTAAACTCCTCATCTACTCCACCGCCCCCTCCTACTCA---------ACCTCCGCGACATGTACACTGACCATCCGCGGAAAGGTGAGG
TRN  10010101100011001
NAM  COAT_TYMV/7-178
ASQ  LAPQDRTVTVATVLPAVPGPSPLTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPTFPTTVGVCWVPANSPVTPAQITK--TYGGQIFCIGGAINTLSPLIVKCPLEMMNPRVKDSIQYLDSPKLLISITAQPTAP--PASTCIITVSGTLS
DSQ  CTCGCCCCCCAAGACCGCACCGTCACCGTCGCCACCGTTCTACCAGCTGTCCCCGGCCCATCACCTCTCACCATCAAACAACCGTTCCAGTCTGAAGTTCTATTTGCTGGAACCAAAGATGCCGAGGCTTCTCTCACCATCGCCAACATCGACAGCGTTTCCACCCTCACCACCTTCTACCGTCATGCATCTCTGGAATCACTCTGGGTCACTATCCATCCCACCTTGCAAGCCCCAACTTTCCCGACCACGGTCGGTGTCTGCTGGGTACCCGCCAATTCCCCAGTCACTCCCGCCCAAATCACCAAG------ACCTATGGTGGCCAGATCTTCTGCATTGGCGGCGCCATCAACACCCTCTCACCTCTCATCGTCAAGTGCCCACTTGAAATGATGAACCCCCGGGTCAAAGATTCGATTCAGTACCTTGACTCGCCCAAACTCCTCATCTCCATCACGGCTCAACCCACCGCTCCC------CCCGCGTCGACATGCATAATAACTGTATCAGGAACTCTCTCG
TRN  10010101100011001
NAM  COAT_ELV/19-190
ASQ  KLSQKTPVSNFSALPLPNGPQAPTQLQPFQFEFPLPAGQEGSVTLPLATFPKMATFLSRHRRAQLTQLHAVVSPSAVSIGHPLTVQLIWVPASSTTTSSQILG--TYGGQQISVGGQVTNSSPAKVSANLLMMNPHIKDSTSYTDTPKLLVYSTPAVPDDKLTTSSASIIVFGE--
//