EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00979 - Reovirus_cap)
FAM  PF00979
PID  Reovirus_cap
DES  Reovirus outer capsid protein, Sigma 3
IPR  IPR000153
ANO  2
ALN  383
AID  0.254545
APH  (Q86291_9REOV/1-365:1.34258,O12284_9REOV/1-366:0.63356);
ATP  (Q86291_9REOV/1-365,O12284_9REOV/1-366);
ATL  1.97614
DNO  2
DLN  1149
DID  0.380268
DPH  (Q86291_9REOV/1-365:0.18320,O12284_9REOV/1-366:1.13423);
DTP  (Q86291_9REOV/1-365,O12284_9REOV/1-366);
DTL  1.31743
RID  0.254545
RPH  (Q86291_9REOV/1-365:1.34258,O12284_9REOV/1-366:0.63356);
RTP  (Q86291_9REOV/1-365,O12284_9REOV/1-366);
RTL  1.97614
LNK  O12284_9REOV/1-366:O12284:AF004856
LNK  Q86291_9REOV/1-365:Q86291:U15072
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q86291_9REOV/1-365
ASQ  MEVCLPNGHQIVDLINNAFEGRVSIYSAQEGWDKTISAQPDMMVCGGAVVCMHCLGVV--GSLQRKLKHLPHHRCNQQIRHQDYVDVQLA--DRVTAHWKRGMLSFVAQMHAMMNDVSPDDLDRVRTEGGSLVELNWLQIDPNSMFR-SI-HSSWTDPLQVVDDLDTKLDQYWTALNLMIDSSD---LIPNFMMRDPS-HAFNGVKLEGDARQTQFSRTFDSRSSLEWGVMVYDYSELEHDPLKGR-AYRKELVTPARDFGHFGLSHYSRATTPILGKMPAVFSGMLTGNCKMYPFIKGTAKLKTVRKLVEAVNHAWGVEKIRYALG--PG---GMTGWYNRTM--QQAPIVLTPAALTMFPDTTKFGDLNYPVMIGDPMILG
DSQ  ATGGAGGTGTGCTTGCCCAACGGTCATCAGATCGTGGACTTAATTAACAACGCTTTTGAAGGTCGTGTATCAATCTACAGCGCGCAAGAGGGATGGGACAAAACAATCTCAGCACAGCCAGACATGATGGTATGTGGTGGCGCCGTCGTTTGCATGCATTGTCTAGGTGTTGTT------GGATCTCTACAACGCAAGCTGAAGCATTTGCCTCACCATAGATGTAATCAACAGATCCGTCATCAGGATTACGTCGATGTACAGCTCGCA------GACCGTGTTACTGCTCACTGGAAGCGGGGTATGCTGTCCTTCGTTGCGCAGATGCACGCGATGATGAATGACGTGTCGCCAGATGACCTGGATCGTGTGCGTACTGAGGGAGGTTCACTAGTGGAGCTGAACTGGCTTCAGATTGACCCAAATTCAATGTTTAGA---TCAATA---CACTCAAGTTGGACAGATCCTTTGCAGGTGGTGGACGACCTTGACACTAAGCTGGATCAGTACTGGACGGCCTTAAACCTGATGATCGACTCATCCGAC---------TTGATACCCAACTTTATGATGAGAGACCCATCA---CACGCGTTCAATGGCGTGAAACTGGAGGGAGATGCTCGTCAAACCCAATTCTCTAGGACTTTTGATTCGAGATCGAGTTTGGAATGGGGTGTGATGGTTTATGATTACTCTGAGCTGGAGCATGATCCATTGAAGGGCCGT---GCTTACAGAAAGGAATTGGTGACGCCAGCTCGAGATTTCGGTCACTTTGGATTATCCCATTATTCTAGGGCGACTACCCCAATCCTCGGAAAGATGCCGGCCGTATTCTCAGGGATGTTGACTGGGAACTGTAAAATGTATCCATTCATTAAAGGAACGGCTAAGTTGAAGACAGTGCGCAAGCTAGTGGAGGCAGTCAATCATGCTTGGGGTGTCGAGAAGATTAGATATGCTCTTGGG------CCAGGT---------GGCATGACGGGATGGTACAATAGGACTATG------CAACAGGCCCCCATTGTGCTAACGCCTGCTGCTCTCACAATGTTCCCAGATACCACCAAGTTTGGGGATTTGAATTATCCAGTGATGATTGGCGATCCGATGATTCTTGGC
TRN  10010101100011000
NAM  O12284_9REOV/1-366
ASQ  MEVRVPNFHSFVEGITSSYLKTPACWNAQTAWDTVTFHVPDVIRVGNAYCCSQCCGVLYYGTLPADGNYFPHHKCHQQQYRTDTPLLRYVRIGRTTEHLLDQYAVALESIADHYDEISQRMVD--EPENDEVAPLDIVTRTESIRSDKTVDPDFWTYPLERRSD-DSRRD-IAASCWRMIDASSRSLTLPNCLVS-PSLHSR-SVFGQMQTTTTIYD-VAASGKAVKFSPMVATLSQRDAGPVKLANADPAEGVYSFWTS-HFAFSPLIGG-VGITGQY-ARESYHHVG----HPVIGSGKKASHYRNLFMESWRGWSKSAFACATGMEPAECESRLRGHARTMLGRSLPNVCDDEVAQQSGAVLTSLQKTTKFTVVE---CG
DSQ  ATGGAGGTACGTGTGCCAAACTTTCACTCGTTCGTTGAAGGAATAACATCTAGCTATTTGAAGACTCCTGCTTGCTGGAATGCACAGACAGCCTGGGACACTGTGACTTTTCACGTCCCTGATGTAATTAGAGTTGGCAATGCGTATTGTTGCTCTCAATGTTGTGGTGTACTTTATTACGGGACTCTGCCCGCGGATGGAAATTACTTCCCTCATCACAAATGCCATCAGCAACAGTACAGGACCGATACCCCACTGCTCCGGTATGTGCGAATTGGCAGAACGACTGAGCATCTGTTGGACCAATATGCTGTTGCGCTGGAGTCTATTGCTGATCACTATGATGAAATCAGTCAACGCATGGTCGAT------GAGCCAGAGAACGATGAAGTCGCGCCCCTTGACATTGTAACGCGTACTGAATCTATCCGAAGTGATAAGACGGTTGACCCGGACTTTTGGACTTACCCGCTTGAGCGACGTTCTGAT---GATTCTCGTCGAGAC---ATCGCCGCATCATGCTGGAGAATGATTGATGCATCATCACGTAGTCTCACTCTTCCAAATTGTCTTGTGTCC---CCGTCTTTGCATTCTCGT---TCCGTCTTTGGTCAAATGCAAACGACCACCACCATATACGAT---GTTGCGGCGTCGGGAAAGGCCGTTAAATTTTCTCCGATGGTGGCTACACTATCGCAACGTGATGCTGGCCCTGTAAAGCTTGCGAATGCTGACCCAGCGGAAGGTGTATATTCATTTTGGACGTCG---CACTTCGCCTTCTCACCGCTCATTGGTGGA---GTTGGGATTACGGGACAGTAC---GCTCGTGAGTCATACCATCACGTGGGT------------CATCCAGTGATTGGGAGTGGTAAGAAGGCATCACACTACAGAAATCTGTTTATGGAATCATGGCGTGGGTGGTCAAAGTCAGCTTTCGCATGCGCTACAGGAATGGAGCCAGCTGAATGTGAATCTCGTCTGAGGGGACATGCTCGCACTATGCTTGGACGCTCTCTGCCGAACGTCTGTGACGACGAGGTTGCTCAGCAGTCTGGCGCCGTGCTAACGTCCCTGCAGAAGACTACCAAGTTCACTGTTGTGGAG---------TGTGGT
TRN  10010101100011001
//