EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00971 - EIAV_GP90)
FAM  PF00971
PID  EIAV_GP90
DES  EIAV coat protein, gp90
IPR  IPR001361
ANO  3
ALN  392
AID  0.946887
APH  (Q66731_9RETR/42-427:0.07707,O36326_9RETR/42-418:0.02609,ENV_EIAV1/42-432:0.03534);
ATP  (Q66731_9RETR/42-427,O36326_9RETR/42-418,ENV_EIAV1/42-432);
ATL  0.1385
DNO  3
DLN  1176
DID  0.960887
DPH  (Q66731_9RETR/42-427:0.04346,O36326_9RETR/42-418:0.01076,ENV_EIAV1/42-432:0.01415);
DTP  (Q66731_9RETR/42-427,O36326_9RETR/42-418,ENV_EIAV1/42-432);
DTL  0.06837
RID  0.946887
RPH  (Q66731_9RETR/42-427:0.07707,O36326_9RETR/42-418:0.02609,ENV_EIAV1/42-432:0.03534);
RTP  (Q66731_9RETR/42-427,O36326_9RETR/42-418,ENV_EIAV1/42-432);
RTL  0.1385
LNK  ENV_EIAV1/42-432:P22427:M18385
LNK  O36326_9RETR/42-418:O36326:AF005117
LNK  Q66731_9RETR/42-427:Q66731:M87580
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q66731_9RETR/42-427
ASQ  SKNSMAESKEARDQEMNLKEESKEEKRRNDWWKIGMFLLCLAGTTGGILWWYEGLSQQHYIGLVAIGGRLNGSGQSNAIECWGSFPGCRPFQNYFSYETNRSIHMNNNTATLLEAYHREIPFIYKSSWTDSDHCQEYQCQKVD------FNANSFYPVNESTEYWGFKWLECNQTENLKTILVPENEMVNINDSDTWIPKGCNETWARVKRCPIDILYGIHPIRLCVQPPFFLVQENGAANNSRISNCGPTIFLGVLEDNKGVIRGNSTICKVNITEIKRKDYTGIYQVPIFYTCNFTNITSCNNESIISVIMYETNQVQYLLCNKNNNSNNYNCVVQSFGVIGQAHLELPRLNKRIRNQSFNQYNCSINNKTELETWKLVKTSGITPLPIS
DSQ  AGTAAGAACAGCATGGCAGAATCGAAGGAAGCAAGAGACCAAGAAATGAACCTGAAAGAAGAATCTAAAGAAGAAAAAAGAAGAAATGACTGGTGGAAAATAGGTATGTTTCTGTTATGCTTAGCAGGAACTACTGGAGGAATACTTTGGTGGTATGAAGGACTCTCACAGCAACATTATATAGGGTTGGTGGCGATAGGGGGAAGATTAAACGGATCTGGCCAATCAAATGCTATAGAATGCTGGGGTTCCTTCCCGGGGTGTAGACCATTTCAAAATTACTTTAGTTATGAGACCAATAGAAGCATACATATGAATAATAATACTGCTACATTATTAGAAGCTTATCATAGAGAGATACCATTCATTTATAAGTCTTCTTGGACAGATAGTGATCATTGTCAAGAGTATCAATGTCAAAAAGTTGAT------------------TTTAATGCAAATTCCTTTTACCCTGTAAATGAGAGTACGGAATATTGGGGATTTAAATGGCTAGAATGTAATCAAACAGAAAATCTTAAGACTATATTAGTACCTGAAAATGAAATGGTAAATATCAATGATAGTGATACCTGGATACCTAAGGGGTGTAATGAGACGTGGGCAAGAGTGAAACGTTGTCCTATAGATATTTTATATGGGATACATCCAATCAGGCTGTGTGTACAGCCACCATTTTTTCTGGTACAGGAGAACGGGGCTGCTAACAATTCTAGAATTAGCAATTGTGGGCCAACAATATTTCTTGGGGTTTTAGAAGATAATAAGGGAGTAATACGGGGGAATAGTACAATTTGCAAAGTGAATATCACAGAAATAAAGAGAAAGGATTATACAGGGATCTATCAAGTACCTATATTTTATACATGTAATTTCACTAACATAACTTCCTGCAATAATGAGTCGATAATCAGTGTTATCATGTATGAAACAAACCAGGTACAATATTTGTTGTGTAATAAGAATAATAATAGTAATAATTATAATTGTGTAGTACAAAGTTTTGGAGTTATAGGACAGGCACACTTAGAACTGCCTAGACTTAACAAAAGAATAAGGAACCAAAGCTTTAACCAATATAACTGCTCTATCAATAACAAAACAGAATTAGAAACATGGAAGTTAGTAAAGACTTCTGGCATAACTCCTTTACCTATTTCT
TRN  10010101100011000
NAM  O36326_9RETR/42-418
ASQ  SKNSMAESKEARDQEMNLKEESKEEKRRNDWWKIGMFLLCLAGTTGGILWWYEGLPQQHYIGLVAIGGRLNGSGQSNAIECWGSFPGCRPFQNYFSYETNRSMHIDNNTATLLEAYHREITFIYKSSCTDSDHCQEYQCKKVN--------------LMNTTEYWGFKWLECNQTENFKTILVPENEMVNINDNDTWIPKGCNETWARVKRCPIDILYGIHPIRLCVQPPFFLVQGKGIANTSRIGNCGPTIFLGVLEDNKGVVRGNYTACNVSRLEINRKDYTGIYQVPIFYTCNFTNITSCNNESIISVIMYETNQVQYLLCN-NNNSDHYNCVIQSFGVIGQAHLELPRPNKRIRNQSFNQYNCSINNKTELETWKLVKTSGITPLPIS
DSQ  AGTAAGAACAGCATGGCAGAATCGAAGGAAGCAAGAGACCAAGAAATGAACCTGAAAGAAGAATCTAAAGAAGAAAAAAGAAGAAATGACTGGTGGAAAATAGGTATGTTTCTGTTATGCTTAGCAGGAACTACTGGAGGAATACTTTGGTGGTATGAAGGACTCCCACAGCAACATTATATAGGGTTGGTGGCGATAGGGGGAAGATTAAACGGATCTGGCCAATCAAATGCTATAGAATGCTGGGGTTCCTTCCCGGGGTGTAGACCATTTCAAAATTACTTCAGTTATGAGACCAATAGAAGCATGCATATAGATAATAATACTGCTACATTATTAGAAGCTTATCATAGGGAGATAACATTCATTTATAAGTCTTCTTGCACAGATAGTGATCATTGTCAAGAATATCAATGTAAAAAAGTTAAT------------------------------------------CTTATGAACACAACGGAATATTGGGGATTTAAATGGCTAGAATGTAATCAAACAGAAAATTTTAAGACTATATTAGTACCTGAAAATGAAATGGTAAATATCAATGATAATGATACCTGGATACCTAAGGGGTGTAATGAGACGTGGGCAAGAGTGAAACGTTGTCCTATAGATATTTTATATGGGATACATCCAATCAGGCTGTGTGTACAGCCACCATTTTTTCTGGTACAGGGGAAAGGGATTGCTAATACTTCTAGAATTGGCAATTGTGGGCCAACAATATTTCTTGGGGTTTTAGAAGATAATAAGGGAGTAGTACGGGGGAATTATACAGCTTGCAATGTGAGTCGCCTAGAGATAAATAGAAAGGATTATACAGGGATCTATCAAGTACCTATATTTTATACATGTAATTTCACTAACATAACTTCCTGCAATAATGAGTCAATAATCAGTGTTATCATGTATGAAACAAACCAGGTACAATATTTATTGTGTAAT---AATAATAATAGTGATCATTATAATTGTGTAATACAAAGTTTTGGAGTTATAGGACAGGCACACTTAGAACTGCCTAGACCTAACAAAAGAATAAGGAACCAAAGCTTTAACCAATATAACTGCTCTATAAATAACAAAACAGAATTAGAAACATGGAAGTTAGTAAAGACTTCTGGCATAACTCCTTTACCTATTTCT
TRN  10010101100011000
NAM  ENV_EIAV1/42-432
ASQ  SKNSMAESKEARDQEMNLKEESKEEKRRNDWWKIGMFLLCLAGTTGGILWWYEGLPQQHYIGLVAIGGRLNGSGQSNAIECWGSFPGCRPFQNYFSYETNRSIHMNNNTATLLEAYHREITFIYKSSCTDSDHCQEYQCKKVNLNSSDSSNSVRVEDVTNTAEYWGFKWLECNQTENFKTILVPENEMVNINDTDTWIPKGCNETWARVKRCPIDILYGIHPIRLCVQPPFFLVQEKGIADTSRIGNCGPTIFLGVLEDNKGVVRGDYTACNVRRLNINRKDYTGMYQVPIFYTCTFTNITSCNSEPIISVIMYETNQVQYLLCN-NNNSNNYNCVVQSFGVIGQAHLELPRPNKRIRNQSFNQYNCSINNKTELETWKLVNTSGITPLPIS
DSQ  AGTAAGAACAGCATGGCAGAATCGAAGGAAGCAAGAGACCAAGAAATGAACCTGAAAGAAGAATCTAAAGAAGAAAAAAGAAGAAATGACTGGTGGAAAATAGGTATGTTTCTGTTATGCTTAGCAGGAACTACTGGAGGAATACTTTGGTGGTATGAAGGACTCCCACAGCAACATTATATAGGGTTGGTGGCGATAGGGGGAAGATTAAACGGATCTGGCCAATCAAATGCTATAGAATGCTGGGGTTCCTTCCCGGGGTGTAGACCATTTCAAAATTACTTCAGTTATGAGACCAATAGAAGCATACATATGAATAATAATACTGCTACATTATTAGAAGCTTATCATAGAGAGATAACATTCATTTATAAGTCTTCTTGCACAGATAGTGATCATTGTCAAGAGTATCAATGTAAAAAAGTTAATCTTAATTCCTCTGACTCCTCTAACTCTGTACGTGTTGAGGATGTAACGAACACAGCGGAATATTGGGGATTTAAATGGCTAGAATGTAATCAAACAGAAAATTTTAAGACTATATTAGTACCTGAAAATGAAATGGTAAATATCAATGATACTGATACCTGGATACCTAAGGGGTGTAATGAGACGTGGGCAAGAGTGAAACGTTGTCCTATAGATATTTTATATGGGATACATCCAATCAGGCTGTGTGTACAGCCACCATTTTTTCTGGTACAGGAGAAAGGGATTGCTGATACTTCTAGAATTGGCAATTGTGGGCCAACAATATTTCTTGGGGTTTTAGAAGATAATAAGGGAGTAGTACGGGGGGATTATACAGCTTGCAATGTGCGTCGCCTAAATATAAATAGAAAGGATTATACAGGGATGTATCAAGTACCTATATTTTATACATGTACTTTCACTAACATAACTTCCTGCAATAGTGAGCCAATAATCAGTGTTATCATGTATGAAACAAACCAGGTACAATATTTATTGTGTAAT---AATAATAATAGTAATAATTATAATTGTGTAGTACAAAGTTTTGGAGTTATAGGACAGGCACACTTAGAACTGCCTAGACCTAACAAAAGAATAAGGAACCAAAGCTTTAACCAATATAACTGCTCTATAAATAACAAAACAGAATTAGAAACATGGAAGTTAGTAAACACTTCTGGCATAACTCCTTTACCTATTTCT
TRN  10010101100011000
//