EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00965 - TIMP)
FAM  PF00965
PID  TIMP
DES  Tissue inhibitor of metalloproteinase
IPR  IPR001820
ANO  6
ALN  186
AID  0.497975
APH  (((TIM2_HUMAN/25-203:0.39000,TIM4_HUMAN/28-207:0.32614):0.10862,(TIM3_HUMAN/22-194:0.10704,TIM3_CHICK/23-195:0.10771):0.29889):0.63802,TIM1_HUMAN/22-199:0.12331,TIM1_MOUSE/23-199:0.18628);
ATP  (((TIM2_HUMAN/25-203,TIM4_HUMAN/28-207),(TIM3_HUMAN/22-194,TIM3_CHICK/23-195)),TIM1_HUMAN/22-199,TIM1_MOUSE/23-199);
ATL  2.286
DNO  6
DLN  558
DID  0.573719
DPH  (((TIM4_HUMAN/28-207:0.24175,TIM2_HUMAN/25-203:0.27725):0.11856,(TIM3_HUMAN/22-194:0.13042,TIM3_CHICK/23-195:0.14326):0.15314):0.43722,TIM1_HUMAN/22-199:0.10737,TIM1_MOUSE/23-199:0.14197);
DTP  (((TIM4_HUMAN/28-207,TIM2_HUMAN/25-203),(TIM3_HUMAN/22-194,TIM3_CHICK/23-195)),TIM1_HUMAN/22-199,TIM1_MOUSE/23-199);
DTL  1.75094
RID  0.497975
RPH  (((TIM2_HUMAN/25-203:0.39000,TIM4_HUMAN/28-207:0.32614):0.10862,(TIM3_HUMAN/22-194:0.10704,TIM3_CHICK/23-195:0.10771):0.29889):0.63802,TIM1_HUMAN/22-199:0.12331,TIM1_MOUSE/23-199:0.18628);
RTP  (((TIM2_HUMAN/25-203,TIM4_HUMAN/28-207),(TIM3_HUMAN/22-194,TIM3_CHICK/23-195)),TIM1_HUMAN/22-199,TIM1_MOUSE/23-199);
RTL  2.286
LNK  TIM1_HUMAN/22-199:P01033:X03124
LNK  TIM1_MOUSE/23-199:P12032:X04684
LNK  TIM2_HUMAN/25-203:P16035:J05593
LNK  TIM3_CHICK/23-195:P26652:M94531
LNK  TIM3_HUMAN/22-194:P35625:U14394
LNK  TIM4_HUMAN/28-207:Q99727:U76456
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TIM3_CHICK/23-195
ASQ  EACTCVPIHPQDAFCNSDIVIRAKVVGKKLMKDGPFG------TMRYTVKQMKMYRGFQIM---PHVQYIYTEASESLCGVKLEVN--KYQYLITGRVY-EGKVYTGLCNWYEKWDRLTLSQRKGLNHRYHLGCG-CKIRPCYYLPCFATSKNECIWTDMLSNFGHSGHQAKHYACIQRVEGYCSW
DSQ  GAGGCGTGCACTTGCGTCCCCATCCACCCGCAGGACGCGTTCTGCAACTCCGACATCGTGATCCGTGCTAAAGTTGTGGGGAAGAAGCTCATGAAAGATGGACCATTTGGA------------------ACAATGCGATACACAGTCAAGCAGATGAAGATGTACAGGGGCTTCCAGATAATG---------CCACACGTTCAGTACATCTACACAGAAGCCTCAGAGAGTCTTTGTGGTGTGAAACTGGAGGTCAAC------AAATACCAGTATCTGATTACAGGCCGCGTGTAC---GAAGGGAAGGTTTACACTGGCCTGTGCAATTGGTATGAGAAATGGGACCGACTGACTCTGTCCCAGCGTAAAGGACTGAATCATCGTTATCATCTGGGCTGTGGA---TGCAAGATTCGGCCCTGCTACTATTTGCCCTGCTTTGCCACCTCCAAGAATGAGTGCATTTGGACAGACATGCTCTCCAACTTCGGCCACTCAGGACACCAAGCGAAGCACTATGCCTGCATCCAGAGGGTGGAAGGTTACTGCAGCTGG
TRN  10010101100011001
NAM  TIM3_HUMAN/22-194
ASQ  EACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFG------TLVYTIKQMKMYRGFTKM---PHVQYIHTEASESLCGLKLEVN--KYQYLLTGRVY-DGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCN-CKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSW
DSQ  GAGGCGTGCACATGCTCGCCCAGCCACCCCCAGGACGCCTTCTGCAACTCCGACATCGTGATCCGGGCCAAGGTGGTGGGGAAGAAGCTGGTAAAGGAGGGGCCCTTCGGC------------------ACGCTGGTCTACACCATCAAGCAGATGAAGATGTACCGAGGCTTCACCAAGATG---------CCCCATGTGCAGTACATCCACACGGAAGCTTCCGAGAGTCTCTGTGGCCTTAAGCTGGAGGTCAAC------AAGTACCAGTACCTGCTGACAGGTCGCGTCTAT---GATGGCAAGATGTACACGGGGCTGTGCAACTTCGTGGAGAGGTGGGACCAGCTCACCCTCTCCCAGCGCAAGGGGCTGAACTATCGGTATCACCTGGGTTGTAAC---TGCAAGATCAAGTCCTGCTACTACCTGCCTTGCTTTGTGACTTCCAAGAACGAGTGTCTCTGGACCGACATGCTCTCCAATTTCGGTTACCCTGGCTACCAGTCCAAACACTACGCCTGCATCCGGCAGAAGGGCGGCTACTGCAGCTGG
TRN  10010101100011011
NAM  TIM4_HUMAN/28-207
ASQ  EACSCAPAHPQQHICHSALVIRAKISSEKVVPASADP-ADTEKMLRYEIKQIKMFKGFEKV---KDVQYIYTPFDSSLCGVKLEANS-QKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCG-CQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSW
DSQ  GAGGCATGCAGCTGCGCCCCGGCGCACCCTCAGCAGCACATCTGCCACTCGGCACTTGTGATTCGGGCCAAAATCTCCAGTGAGAAGGTAGTTCCGGCCAGTGCAGACCCT---GCTGACACTGAAAAAATGCTCCGGTATGAAATCAAACAGATAAAGATGTTCAAAGGGTTTGAGAAAGTC---------AAGGATGTTCAGTATATCTATACGCCTTTTGACTCTTCCCTCTGTGGTGTGAAACTAGAAGCCAACAGC---CAGAAGCAGTATCTCTTGACTGGTCAGGTCCTCAGTGATGGAAAAGTCTTCATCCATCTGTGCAACTACATCGAGCCCTGGGAGGACCTGTCCTTGGTGCAGAGGGAAAGTCTGAATCATCACTACCATCTGAACTGTGGC---TGCCAAATCACCACCTGCTACACAGTACCCTGTACCATCTCGGCCCCTAACGAGTGCCTCTGGACAGACTGGCTGTTGGAACGAAAGCTCTATGGTTACCAGGCTCAGCATTATGTCTGTATGAAGCATGTTGACGGCACCTGCAGCTGG
TRN  10010101100011011
NAM  TIM2_HUMAN/25-203
ASQ  DACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPE-----KDIEFIYTAPSSAVCGVSLDVGG-KKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE-CKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAW
DSQ  GACGCCTGCAGCTGCTCCCCGGTGCACCCGCAACAGGCGTTTTGCAATGCAGATGTAGTGATCAGGGCCAAAGCGGTCAGTGAGAAGGAAGTGGACTCTGGAAACGACATTTATGGCAACCCTATCAAGAGGATCCAGTATGAGATCAAGCAGATAAAGATGTTCAAAGGGCCTGAG---------------AAGGATATAGAGTTTATCTACACGGCCCCCTCCTCGGCAGTGTGTGGGGTCTCGCTGGACGTTGGAGGA---AAGAAGGAATATCTCATTGCAGGAAAGGCCGAGGGGGACGGCAAGATGCACATCACCCTCTGTGACTTCATCGTGCCCTGGGACACCCTGAGCACCACCCAGAAGAAGAGCCTGAACCACAGGTACCAGATGGGCTGCGAG---TGCAAGATCACGCGCTGCCCCATGATCCCGTGCTACATCTCCTCCCCGGACGAGTGCCTCTGGATGGACTGGGTCACAGAGAAGAACATCAACGGGCACCAGGCCAAGTTCTTCGCCTGCATCAAGAGAAGTGACGGCTCCTGTGCGTGG
TRN  10010101100011011
NAM  TIM1_MOUSE/23-199
ASQ  KACSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLY-------QRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLR-NGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSED-YQSRHFACLPRNPGLCTW
DSQ  AAGGCCTGTAGCTGTGCCCCACCCCACCCACAGACAGCCTTCTGCAACTCGGACCTGGTCATAAGGGCTAAATTCATGGGTTCCCCAGAAATCAACGAGACCACCTTATAC---------------------CAGCGTTATAAGATCAAGATGACTAAGATGCTAAAAGGATTCAAGGCTGTGGGAAATGCCGCAGATATCCGGTACGCCTACACCCCAGTCATGGAAAGCCTCTGTGGATATGCCCACAAGTCCCAGAACCGCAGTGAAGAGTTTCTCATCACGGGCCGCCTAAGG---AACGGAAATTTGCACATCAGTGCCTGCAGCTTCTTGGTTCCCTGGCGTACTCTGAGCCCTGCTCAGCAAAGAGCTTTCTCAAAGACCTATAGTGCTGGCTGTGGGGTGTGCACAGTGTTTCCCTGTTTATCTATCCCTTGCAAACTGGAGAGTGACACTCACTGTTTGTGGACGGATCAGGTCCTCGTGGGCTCTGAGGAC---TACCAGAGCCGTCACTTTGCTTGCCTGCCACGGAATCCAGGCTTGTGCACCTGG
TRN  10010101100011000
NAM  TIM1_HUMAN/22-199
ASQ  RACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLY-------QRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQ-DGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTW
DSQ  AGGGCCTGCACCTGTGTCCCACCCCACCCACAGACGGCCTTCTGCAATTCCGACCTCGTCATCAGGGCCAAGTTCGTGGGGACACCAGAAGTCAACCAGACCACCTTATAC---------------------CAGCGTTATGAGATCAAGATGACCAAGATGTATAAAGGGTTCCAAGCCTTAGGGGATGCCGCTGACATCCGGTTCGTCTACACCCCCGCCATGGAGAGTGTCTGCGGATACTTCCACAGGTCCCACAACCGCAGCGAGGAGTTTCTCATTGCTGGAAAACTGCAG---GATGGACTCTTGCACATCACTACCTGCAGTTTCGTGGCTCCCTGGAACAGCCTGAGCTTAGCTCAGCGCCGGGGCTTCACCAAGACCTACACTGTTGGCTGTGAGGAATGCACAGTGTTTCCCTGTTTATCCATCCCCTGCAAACTGCAGAGTGGCACTCATTGCTTGTGGACGGACCAGCTCCTCCAAGGCTCTGAAAAGGGCTTCCAGTCCCGTCACCTTGCCTGCCTGCCTCGGGAGCCAGGGCTGTGCACCTGG
TRN  10010101100011010
//