EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00952 - Bunya_nucleocap)
FAM  PF00952
PID  Bunya_nucleocap
DES  Bunyavirus nucleocapsid (N) protein
IPR  IPR001784
ANO  7
ALN  229
AID  0.551377
APH  ((((Q65610_9VIRU/6-233:0.17113,(NCAP_BUNGE/6-233:0.22396,NCAP_BUNYW/6-233:0.08912):0.14771):0.04618,Q65528_BUNYW/6-233:0.14876):0.32657,NCAP_AINOV/7-233:0.51658):0.26607,NCAP_BUNLC/6-234:0.14523,Q88923_9VIRU/6-234:0.19393);
ATP  ((((Q65610_9VIRU/6-233,(NCAP_BUNGE/6-233,NCAP_BUNYW/6-233)),Q65528_BUNYW/6-233),NCAP_AINOV/7-233),NCAP_BUNLC/6-234,Q88923_9VIRU/6-234);
ATL  2.27524
DNO  7
DLN  687
DID  0.594497
DPH  ((Q65610_9VIRU/6-233:0.14545,(Q65528_BUNYW/6-233:0.17404,(NCAP_AINOV/7-233:0.35005,(NCAP_BUNLC/6-234:0.14936,Q88923_9VIRU/6-234:0.17397):0.18214):0.23978):0.09930):0.10166,NCAP_BUNGE/6-233:0.20219,NCAP_BUNYW/6-233:0.10462);
DTP  ((Q65610_9VIRU/6-233,(Q65528_BUNYW/6-233,(NCAP_AINOV/7-233,(NCAP_BUNLC/6-234,Q88923_9VIRU/6-234)))),NCAP_BUNGE/6-233,NCAP_BUNYW/6-233);
DTL  1.92256
RID  0.551377
RPH  ((((Q65610_9VIRU/6-233:0.17113,(NCAP_BUNGE/6-233:0.22396,NCAP_BUNYW/6-233:0.08912):0.14771):0.04618,Q65528_BUNYW/6-233:0.14876):0.32657,NCAP_AINOV/7-233:0.51658):0.26607,NCAP_BUNLC/6-234:0.14523,Q88923_9VIRU/6-234:0.19393);
RTP  ((((Q65610_9VIRU/6-233,(NCAP_BUNGE/6-233,NCAP_BUNYW/6-233)),Q65528_BUNYW/6-233),NCAP_AINOV/7-233),NCAP_BUNLC/6-234,Q88923_9VIRU/6-234);
RTL  2.27524
LNK  NCAP_AINOV/7-233:P12414:M22011
LNK  NCAP_BUNGE/6-233:P16993:M19420
LNK  NCAP_BUNLC/6-234:P04873:K00610
LNK  NCAP_BUNYW/6-233:P16495:D00353
LNK  Q65528_BUNYW/6-233:Q65528:X73466
LNK  Q65610_9VIRU/6-233:Q65610:X73467
LNK  Q88923_9VIRU/6-234:Q88923:U12803
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q88923_9VIRU/6-234
ASQ  FYDAPSTGANGFDPDAGYVAFIAAHAGSYDLSAVRIFFLNAAKAKNALSRKPEGKVSIKFGEWSVEVVNNHFPGNRNNPIGNNDLTIHRISGYLARWVLEEFKGQDDEAQKDIIRSTIVNPIAESNGIHWDSGADAYLSFFPGTEMFLESFDFLPLAIGIYRVKNGMMDVQYLKKALRQRYGTMTADKWMSTKTTVIAKTLKRVESFKWGKGGLSEAARAFLSKFNVKI
DSQ  TTTTATGATGCTCCATCAACAGGTGCAAACGGATTTGATCCCGATGCAGGGTATGTGGCATTTATTGCTGCACATGCCGGATCGTACGATCTTTCTGCTGTTAGGATCTTCTTCCTCAATGCTGCCAAGGCCAAGAATGCTCTCTCGAGAAAACCAGAGGGGAAGGTTAGTATTAAATTTGGCGAGTGGTCGGTGGAGGTGGTCAATAATCATTTTCCTGGCAACAGGAACAATCCAATTGGTAACAACGATCTTACCATCCACAGAATTTCAGGCTATCTCGCAAGATGGGTTCTAGAAGAGTTCAAAGGACAAGATGATGAAGCCCAGAAGGACATCATCCGCTCAACCATTGTGAACCCAATTGCAGAATCCAATGGGATCCACTGGGATAGCGGTGCAGATGCCTACCTGTCATTCTTCCCTGGCACTGAAATGTTTCTGGAATCATTTGATTTCCTCCCATTAGCAATTGGGATCTATAGAGTCAAAAATGGCATGATGGATGTCCAATACCTGAAAAAAGCTCTCCGTCAAAGATACGGGACTATGACAGCAGATAAGTGGATGTCTACTAAGACAACAGTAATTGCAAAGACCCTGAAGAGAGTTGAGAGCTTCAAATGGGGTAAGGGAGGACTAAGTGAGGCAGCCAGAGCATTCCTCTCAAAATTTAATGTAAAAATA
TRN  10010101100011000
NAM  NCAP_BUNLC/6-234
ASQ  FYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRL
DSQ  TTTTATGATGTCGCATCAACAGGTGCAAATGGATTTGATCCTGATGCAGGGTATATGGACTTCTGTGTTAAAAATGCAGAATCACTCAACCTTGCTGCAGTTAGGATCTTCTTCCTCAATGCCGCAAAGGCCAAGGCTGCTCTCTCGCGTAAGCCAGAGAGGAAGGCTAACCCTAAATTTGGAGAGTGGCAGGTGGAGGTTATCAATAATCATTTTCCTGGAAACAGGAACAACCCAATTGGTAACAACGATCTTACCATCCACAGATTATCTGGGTATTTAGCCAGATGGGTCCTTGATCAGTATAACGAGAATGATGATGAGTCTCAGCACGAGTTGATCAGAACAACTATTATCAACCCAATTGCTGAGTCTAATGGTGTGGGATGGGACAGTGGGCCAGAGATCTATCTATCATTCTTTCCAGGAACAGAAATGTTTTTGGAAACTTTCAAATTCTACCCGCTGACCATTGGAATTCACAGAGTCAAGCAAGGCATGATGGACCCTCAATACCTGAAGAAGGCCTTAAGGCAACGCTATGGCACTCTCACAGCAGATAAGTGGATGTCACAGAAGGTTGCAGCAATTGCTAAGAGCCTGAAGGATGTAGAGCAGCTTAAATGGGGAAAAGGAGGCCTGAGCGATACTGCTAAAACATTCCTGCAGAAATTTGGCATCAGGCTT
TRN  10010101100011000
NAM  Q65610_9VIRU/6-233
ASQ  FHDVTANTSSTFDPEAGYAAFKRRHTTGLNYDHIRIFFLNGKKAKDTLSKRSETTITLNFGGWKIPVVNTHFLENRNMSVPDDGLTLHRVSGYLARYLLDRVYSAG-EPEKLKIKTTIINPIAASHGITWDDGEEVYLSFFPGSEMYLTTFKFYPLAIGIYKVQRKLMDPKYLEKTMRQRYMNLDASQWTQKHFSDVNSALTVVAGLGWKKANVSIAAKDFLNKFGINI
DSQ  TTCCATGATGTCACTGCTAACACCAGCAGTACTTTTGATCCAGAAGCCGGGTATGCTGCGTTTAAGCGTAGACACACCACAGGGCTTAATTATGACCACATACGAATCTTCTTTCTTAACGGAAAGAAGGCTAAAGATACTCTCTCAAAGAGAAGTGAGACAACAATTACGCTTAACTTTGGGGGCTGGAAGATACCTGTGGTTAATACGCATTTTCTTGAGAACAGGAACATGTCAGTTCCAGATGATGGTCTTACCCTCCACAGAGTCAGTGGATATCTTGCCAGGTACCTGCTTGACAGAGTATACTCTGCTGGA---GAACCAGAGAAACTAAAAATAAAAACAACAATTATAAATCCGATTGCTGCTTCTCATGGTATAACGTGGGATGATGGAGAAGAAGTTTACTTATCCTTCTTCCCTGGCTCAGAGATGTACTTAACCACATTCAAATTTTACCCATTAGCTATTGGCATTTACAAGGTCCAGAGGAAATTGATGGACCCAAAGTATCTTGAGAAAACAATGCGTCAGAGGTACATGAACTTGGATGCATCCCAATGGACTCAGAAACACTTCTCAGATGTCAACAGTGCACTTACTGTAGTCGCTGGCTTAGGGTGGAAGAAAGCCAATGTTAGCATTGCAGCCAAAGATTTCCTGAATAAATTCGGAATAAACATC
TRN  10010101100011000
NAM  Q65528_BUNYW/6-233
ASQ  FFDVAQNATSTFNPELQYATFKRTNTTGLNYDNIRIFYLNGKRSKDTLSKRSEQSVVLNFGGWRIPVVNTHFPGNRNSPVLDDSFTLHRVSGYLARYLLERYLTVS-APEQAIIRSKIINPIAASNGITWEDGPEVYLSFFPGTEMFLETFKFYPLAIGIYKVQKKMMEAKYLEKTMRQKYAGLDASQWTQQKYNEINAALSVVSSLGWKKANVSSAAREFLARFGISL
DSQ  TTCTTTGACGTTGCTCAAAATGCAACAAGTACGTTTAACCCGGAGCTCCAATATGCTACATTTAAACGTACAAACACAACAGGGCTTAATTACGACAATATTAGAATCTTCTATCTCAATGGGAAGAGATCCAAAGATACTCTCTCTAAGAGAAGTGAACAATCGGTTGTTCTTAACTTTGGAGGCTGGAGAATTCCTGTGGTTAATACACATTTTCCTGGAAACCGGAACAGTCCAGTCCTCGATGATTCATTCACACTTCATAGAGTAAGTGGTTACCTGGCAAGGTACTTACTTGAAAGATATTTAACTGTATCA---GCACCTGAGCAAGCAATCATCAGGTCAAAAATCATAAACCCTATAGCTGCATCAAACGGGATCACATGGGAAGATGGACCAGAGGTTTATCTTTCCTTTTTCCCAGGTACTGAAATGTTCCTGGAGACTTTCAAATTCTACCCCCTTGCAATTGGAATATACAAAGTTCAGAAAAAGATGATGGAGGCTAAATACTTGGAGAAAACTATGAGACAGAAATATGCTGGGTTAGATGCATCTCAATGGACGCAACAAAAATATAATGAGATCAATGCTGCTCTTTCTGTTGTCTCATCACTAGGTTGGAAGAAAGCCAATGTTAGCTCTGCTGCTAGAGAATTTTTGGCTAGATTTGGAATATCTCTG
TRN  10010101100011000
NAM  NCAP_BUNYW/6-233
ASQ  FHDVAANTSSTFDPEVAYANFKRVHTTGLSYDHIRIFYIKGREIKTSLAKRSEWEVTLNLGGWKITVYNTNFPGNRNNPVPDDGLTLHRLSGFLARYLLEKMLKVS-EPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMFLGTFRFYPLAIGIYKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTEVQSALTVVSSLGWKKTNVSAAARDFLAKFGINM
DSQ  TTTCATGATGTCGCTGCTAACACCAGCAGTACTTTTGACCCAGAGGTCGCATACGCTAACTTTAAGCGTGTCCACACCACTGGGCTTAGTTATGACCACATACGAATCTTCTACATTAAAGGACGCGAGATTAAAACTAGTCTCGCAAAAAGAAGTGAATGGGAAGTTACACTTAACCTTGGGGGCTGGAAGATTACTGTATATAATACGAATTTTCCTGGCAACCGGAACAACCCAGTTCCTGACGATGGTCTTACCCTCCACCGCCTCAGTGGATTCCTTGCCAGGTACCTACTTGAGAAGATGCTGAAAGTCAGT---GAACCAGAGAAATTGATTATTAAATCAAAAATAATCAACCCTTTGGCTGAAAAGAATGGGATCACTTGGAATGATGGAGAGGAAGTTTATCTCTCTTTCTTCCCAGGATCAGAGATGTTCTTAGGAACTTTCAGATTCTACCCCTTAGCAATCGGGATCTACAAAGTTCAGCGCAAGGAAATGGAACCAAAATACCTTGAGAAAACAATGCGGCAGAGGTACATGGGACTAGAAGCAGCAACTTGGACTGTTAGTAAATTGACAGAAGTTCAGTCTGCACTGACAGTTGTCTCTAGCTTAGGTTGGAAGAAAACCAATGTTAGTGCAGCTGCCAGGGACTTCCTTGCTAAATTCGGAATCAACATG
TRN  10010101100011000
NAM  NCAP_BUNGE/6-233
ASQ  FEDVPNNIGSTFDPESGYTNFQRNYLPGVTLDQIRIFYIKGREIKNSLSKRSEWEVTLNLGGWKVPVLNTNFPGNRNNAVPDYGLTFHRISGYLARYLLGKYLAET-EPEKLIMRTKIVNPLAEKNGITWESGPEVYLSFFPGAEMFLGTFRFYPLAIGIYKVQRKEMDPKFLEKTMRQRYLGIDAQTWTTTKLGEVEAALKVVSGLGWKKTNVSSAAREFLSKFGIRM
DSQ  TTTGAAGATGTCCCTAATAACATCGGGAGTACTTTTGACCCAGAGTCAGGATACACTAACTTTCAGCGTAACTACCTGCCAGGGGTTACGCTTGACCAAATTCGCATCTTCTACATTAAAGGACGCGAGATTAAAAATAGTCTCTCAAAAAGAAGTGAATGGGAAGTTACGCTTAACCTTGGGGGCTGGAAGGTACCTGTACTCAATACGAATTTCCCTGGAAACAGGAACAATGCAGTGCCTGACTACGGTCTTACCTTCCACCGTATCAGTGGATACCTTGCCCGGTACCTACTTGGAAAGTACCTTGCAGAGACA---GAACCAGAAAAGCTCATAATGAGAACAAAAATTGTGAACCCTCTTGCTGAGAAGAATGGCATCACATGGGAGAGCGGGCCAGAAGTCTACCTGTCCTTCTTCCCAGGTGCTGAAATGTTCCTTGGAACTTTCAGATTCTACCCACTTGCCATTGGGATCTACAAAGTGCAGAGGAAAGAAATGGACCCAAAATTTCTGGAGAAGACTATGCGCCAGAGGTACCTTGGCATTGATGCTCAGACATGGACAACAACTAAGCTTGGAGAAGTGGAAGCAGCTTTAAAAGTAGTCTCAGGGCTCGGATGGAAGAAGACAAATGTCAGCAGTGCTGCAAGGGAGTTCCTATCCAAATTCGGCATCAGGATG
TRN  10010101100011000
NAM  NCAP_AINOV/7-233
ASQ  FQDVPQRNLATFNPEVGYVAFIAKHGAQLNFDTVRFFFLNQKKAKMVLSKTAQPSVDLTFGGIKFTLVNNHFPQYTANPVPDTALTLHRLSGYLAKWVADQCKTNQ--IKLAEAMEKIVMPLAEVKGCTWTEGLTMYLGFAPGAEMFLETFEFYPLVIDMHRVLKDGMDVNFMRKVLRQRYGTLTAEQWMTQKIDAVRAAFNAVGQLSWAKSGFSPAARAFLAQFGINI
DSQ  TTCCAAGATGTTCCTCAACGGAATCTCGCTACGTTTAACCCGGAGGTCGGGTATGTGGCATTTATTGCTAAACATGGGGCCCAACTCAATTTCGATACCGTTAGATTCTTCTTCCTCAATCAGAAGAAGGCCAAGATGGTACTCAGTAAGACGGCACAACCAAGTGTTGATCTTACATTTGGTGGCATCAAGTTTACACTGGTTAATAACCATTTTCCCCAATACACAGCAAATCCTGTGCCAGACACTGCCCTCACTCTCCATCGTCTCTCAGGATATCTAGCAAAATGGGTTGCAGACCAATGTAAAACGAATCAG------ATTAAATTGGCTGAGGCCATGGAAAAAATTGTCATGCCACTGGCTGAAGTGAAAGGTTGCACCTGGACTGAAGGGCTGACTATGTATCTGGGATTTGCACCAGGTGCTGAAATGTTTTTAGAAACATTTGAATTCTACCCTTTGGTTATTGATATGCACAGAGTGCTGAAGGATGGAATGGATGTCAACTTCATGAGGAAGGTCCTTCGCCAGCGCTACGGCACATTGACTGCAGAACAGTGGATGACTCAAAAAATAGATGCTGTCCGTGCAGCCTTCAATGCTGTTGGGCAGCTAAGCTGGGCTAAATCAGGATTCTCACCAGCTGCTAGAGCCTTCCTTGCCCAATTTGGCATAAACATC
TRN  10010101100011000
//