EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00932 - IF_tail)
FAM  PF00932
PID  IF_tail
DES  Intermediate filament tail domain
IPR  IPR001322
ANO  24
ALN  127
AID  0.38864
APH  ((((((((((((IFA2_CAEEL/454-574:0.26260,Q17048_9BILA/507-628:0.05497):0.07510,((IFA4_CAEEL/453-572:0.29979,IFA1_CAEEL/452-572:0.13691):0.08323,AV71_ACAVI/269-389:0.09444):0.03383):0.08743,Q17050_9BILA/483-604:0.40340):0.10596,(IFEB_ASCSU/463-584:0.21498,IFB2_CAEEL/417-538:0.80283):0.07296):0.08500,((NF70_LOLPE/496-612:0.42676,Q25017_HELAS/518-642:0.24643):0.16065,(Q25089_HAEMA/476-595:0.53431,Q25421_LUMTE/476-593:0.52070):0.27069):0.10817):0.57437,(LMN1_CAEEL/434-550:0.71345,(LAM0_DROME/458-578:0.46195,LAMC_DROME/465-582:0.53232):0.36648):0.22654):0.06210,(LAM1_CHICK/426-545:0.14480,LAML1_XENLA/426-545:0.11793):0.27845):0.08197,(LAM2_CHICK/442-562:0.03427,LAML2_XENLA/465-585:0.17487):0.12837):0.04729,LAM2_MOUSE/435-551:0.33442):0.12174,LAML3_XENLA/426-546:0.47460):0.15262,LAMA_XENLA/422-542:0.07295):0.15201,LAMA_CHICK/426-546:0.09029,LAMA_HUMAN/425-545:0.09215);
ATP  ((((((((((((IFA2_CAEEL/454-574,Q17048_9BILA/507-628),((IFA4_CAEEL/453-572,IFA1_CAEEL/452-572),AV71_ACAVI/269-389)),Q17050_9BILA/483-604),(IFEB_ASCSU/463-584,IFB2_CAEEL/417-538)),((NF70_LOLPE/496-612,Q25017_HELAS/518-642),(Q25089_HAEMA/476-595,Q25421_LUMTE/476-593))),(LMN1_CAEEL/434-550,(LAM0_DROME/458-578,LAMC_DROME/465-582))),(LAM1_CHICK/426-545,LAML1_XENLA/426-545)),(LAM2_CHICK/442-562,LAML2_XENLA/465-585)),LAM2_MOUSE/435-551),LAML3_XENLA/426-546),LAMA_XENLA/422-542),LAMA_CHICK/426-546,LAMA_HUMAN/425-545);
ATL  10.5024
DNO  23
DLN  381
DID  0.477299
DPH  ((((((IFA2_CAEEL/454-574:0.23595,(((((IFB2_CAEEL/417-538:0.61423,IFA4_CAEEL/453-572:0.22860):0.12746,IFA1_CAEEL/452-572:0.13235):0.10019,AV71_ACAVI/269-389:0.14997):0.05643,Q17048_9BILA/507-628:0.24505):0.04686,Q17050_9BILA/483-604:0.36808):0.06125):0.13732,((NF70_LOLPE/496-612:0.31031,Q25017_HELAS/518-642:0.29437):0.11834,(Q25089_HAEMA/476-595:0.36210,Q25421_LUMTE/476-593:0.33107):0.15492):0.09738):0.31487,LAML3_XENLA/426-546:0.39006):0.05759,((LAM2_MOUSE/435-551:0.29606,((LAM1_CHICK/426-545:0.11404,LAML1_XENLA/426-545:0.18231):0.25734,(LAM2_CHICK/442-562:0.11957,LAML2_XENLA/465-585:0.18450):0.06513):0.09847):0.08007,((LAMA_CHICK/426-546:0.12201,LAMA_HUMAN/425-545:0.12790):0.11072,LAMA_XENLA/422-542:0.18636):0.16133):0.07834):0.20284,LMN1_CAEEL/434-550:0.52660):0.16993,LAM0_DROME/458-578:0.37001,LAMC_DROME/465-582:0.35877);
DTP  ((((((IFA2_CAEEL/454-574,(((((IFB2_CAEEL/417-538,IFA4_CAEEL/453-572),IFA1_CAEEL/452-572),AV71_ACAVI/269-389),Q17048_9BILA/507-628),Q17050_9BILA/483-604)),((NF70_LOLPE/496-612,Q25017_HELAS/518-642),(Q25089_HAEMA/476-595,Q25421_LUMTE/476-593))),LAML3_XENLA/426-546),((LAM2_MOUSE/435-551,((LAM1_CHICK/426-545,LAML1_XENLA/426-545),(LAM2_CHICK/442-562,LAML2_XENLA/465-585))),((LAMA_CHICK/426-546,LAMA_HUMAN/425-545),LAMA_XENLA/422-542))),LMN1_CAEEL/434-550),LAM0_DROME/458-578,LAMC_DROME/465-582);
DTL  8.71134
RID  0.385528
RPH  ((((((((((((IFA2_CAEEL/454-574:0.26288,Q17048_9BILA/507-628:0.05275):0.09863,AV71_ACAVI/269-389:0.10241):0.01778,(IFA4_CAEEL/453-572:0.27763,IFA1_CAEEL/452-572:0.15400):0.07320):0.06453,Q17050_9BILA/483-604:0.42357):0.11166,(IFB2_CAEEL/417-538:0.74249,((NF70_LOLPE/496-612:0.41323,Q25017_HELAS/518-642:0.25580):0.19107,(Q25089_HAEMA/476-595:0.51292,Q25421_LUMTE/476-593:0.54770):0.23438):0.15884):0.02575):0.56968,(LMN1_CAEEL/434-550:0.70235,(LAM0_DROME/458-578:0.45662,LAMC_DROME/465-582:0.53389):0.36700):0.20760):0.07372,(LAM1_CHICK/426-545:0.14514,LAML1_XENLA/426-545:0.11749):0.26412):0.09621,(LAM2_CHICK/442-562:0.03569,LAML2_XENLA/465-585:0.17370):0.12464):0.04827,LAM2_MOUSE/435-551:0.33800):0.11971,LAML3_XENLA/426-546:0.47521):0.15129,LAMA_XENLA/422-542:0.07140):0.15370,LAMA_CHICK/426-546:0.09028,LAMA_HUMAN/425-545:0.09203);
RTP  ((((((((((((IFA2_CAEEL/454-574,Q17048_9BILA/507-628),AV71_ACAVI/269-389),(IFA4_CAEEL/453-572,IFA1_CAEEL/452-572)),Q17050_9BILA/483-604),(IFB2_CAEEL/417-538,((NF70_LOLPE/496-612,Q25017_HELAS/518-642),(Q25089_HAEMA/476-595,Q25421_LUMTE/476-593)))),(LMN1_CAEEL/434-550,(LAM0_DROME/458-578,LAMC_DROME/465-582))),(LAM1_CHICK/426-545,LAML1_XENLA/426-545)),(LAM2_CHICK/442-562,LAML2_XENLA/465-585)),LAM2_MOUSE/435-551),LAML3_XENLA/426-546),LAMA_XENLA/422-542),LAMA_CHICK/426-546,LAMA_HUMAN/425-545);
RTL  10.1407
LNK  AV71_ACAVI/269-389:Q17107:X68557
LNK  IFA1_CAEEL/452-572:P90901:X70834
LNK  IFA2_CAEEL/454-574:O02365:X70835
LNK  IFA4_CAEEL/453-572:P90900:X70833
LNK  IFB2_CAEEL/417-538:Q19286:U49831
LNK  IFEB_ASCSU/463-584:P23731:
LNK  LAM0_DROME/458-578:P08928:X16275
LNK  LAM1_CHICK/426-545:P14731:X16878
LNK  LAM2_CHICK/442-562:P14732:X16880
LNK  LAM2_MOUSE/435-551:P21619:X54098
LNK  LAMA_CHICK/426-546:P13648:X16879
LNK  LAMA_HUMAN/425-545:P02545:X03445
LNK  LAMA_XENLA/422-542:P11048:X06345
LNK  LAMC_DROME/465-582:Q03427:L07933
LNK  LAML1_XENLA/426-545:P09010:X06344
LNK  LAML2_XENLA/465-585:P21910:X54099
LNK  LAML3_XENLA/426-546:P10999:X13169
LNK  LMN1_CAEEL/434-550:Q21443:Z96047
LNK  NF70_LOLPE/496-612:Q01241:M64718
LNK  Q17048_9BILA/507-628:Q17048:X86089
LNK  Q17050_9BILA/483-604:Q17050:X86091
LNK  Q25017_HELAS/518-642:Q25017:X86347
LNK  Q25089_HAEMA/476-595:Q25089:U22459
LNK  Q25421_LUMTE/476-593:Q25421:X83734
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q25421_LUMTE/476-593
ASQ  EMSVKTTYQKSAKGPVAIYECSQDGKTVALENTGR-..-KDELKGNWSLTRNIDGKD--VATYKFSDSFVLRPGQKIKGWAKGTRPFTGASG--DIESDQNWES-SHIITKLVNPLGEDRATHIQQT
DSQ  GAAATGTCAGTGAAGACAACCTATCAGAAAAGCGCAAAAGGTCCGGTTGCCATTTACGAGTGTTCTCAAGACGGCAAAACCGTTGCCCTGGAAAACACCGGAAGA---......---AAGGATGAATTGAAGGGCAACTGGAGTCTGACTCGCAACATTGATGGAAAGGAT------GTTGCCACTTACAAGTTCAGCGATTCCTTTGTTCTACGACCAGGACAGAAAATCAAGGGTTGGGCGAAGGGAACAAGACCTTTCACAGGGGCATCAGGT------GACATCGAATCGGACCAGAACTGGGAGTCG---TCGCATATCATCACCAAACTGGTCAACCCTCTCGGAGAGGATCGTGCAACGCACATTCAACAGACG
TRN  10010101100011001
NAM  Q25089_HAEMA/476-595
ASQ  LVGGRTSYQRNARGPVSIAECSPDGKFVILENTGK-..-RREELGGFTLRRKVDGKD--VPVYTFKADAGIDPHMKIKLWVKGAKPSNATAS-DIEVDILDWGTGQNITTQLFNTSGQDRASHIQKT
DSQ  CTTGTTGGTGGAAGAACCAGCTACCAGAGGAACGCCAGAGGACCCGTTTCCATTGCCGAATGCTCTCCAGATGGCAAATTCGTCATTCTTGAAAACACCGGCAAG---......---AGGAGGGAGGAACTCGGAGGTTTCACCTTGAGGAGAAAGGTCGATGGAAAGGAC------GTTCCAGTCTACACCTTCAAGGCTGATGCCGGTATTGACCCACACATGAAGATCAAGTTGTGGGTGAAGGGAGCCAAGCCAAGCAACGCCACTGCTTCG---GACATTGAAGTCGATATCCTTGACTGGGGTACTGGCCAAAACATCACCACCCAACTCTTCAACACATCCGGACAGGATCGTGCTTCCCACATTCAGAAGACC
TRN  10010101110011011
NAM  Q25017_HELAS/518-642
ASQ  EVSAKTTYQRTANGPVSIAEANPEGKFILIENNSSGgvRKEVNLDGWKLQRIVDNNVKKPYVYTFR-NFVLKPSKNVKIFARSLA-SQAGPNDLVFRDADTWGAGAEVVTTLINEKGEEKASHIQKT
DSQ  GAAGTGTCGGCTAAAACTACTTACCAGAGAACAGCAAATGGCCCGGTCAGCATTGCTGAAGCCAACCCTGAGGGAAAGTTCATTTTAATAGAGAATAACTCATCTGGGggagtcAGGAAGGAGGTGAACTTAGATGGCTGGAAGCTGCAGCGTATTGTGGACAACAACGTCAAGAAACCTTATGTATACACGTTTAGA---AATTTTGTGCTGAAGCCAAGCAAGAATGTCAAGATCTTTGCAAGATCACTGGCA---TCCCAGGCCGGGCCCAATGATCTGGTTTTCCGTGATGCCGACACTTGGGGTGCTGGTGCAGAAGTCGTAACCACCCTCATCAATGAAAAGGGAGAGGAGAAAGCCAGCCACATTCAGAAGACC
TRN  10010101100011000
NAM  NF70_LOLPE/496-612
ASQ  ELAAKTTYQRTSKGSVSIKEADSQGCFIALET----..KKEENLTGWKIVRKVDDN--KVYTYEIP-NLVLKTGTVVKIWSKNHQ-AQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQNT
DSQ  GAGTTGGCTGCCAAAACCACTTATCAGAGAACATCAAAAGGATCAGTATCCATCAAGGAAGCTGACTCTCAAGGATGCTTCATTGCTTTGGAAACC------------......AAAAAGGAAGAGAATTTGACAGGCTGGAAGATTGTGAGAAAGGTTGACGACAAC------AAGGTTTACACATATGAAATCCCT---AATTTGGTTTTGAAAACCGGAACGGTTGTCAAGATCTGGTCCAAGAACCACCAG---GCACAGGCTCGCGGTGATGATTTAGTCAGCAGGGAGAATGATACGTGGGGAACTGGGTCCAATGTTGTCACCATTCTGCAAAACGAGAAAGGAGAAGATAAAGCAAACTACACTCAGAATACC
TRN  10010101100011000
NAM  Q17050_9BILA/483-604
ASQ  ETTSKIHYHATAKGNLSIQDASVDGKFIVIENTSPT..-KEENIGEWQIKRSADNG--PEVVFTFPKGFILKPLKTVKIWARDQGGEDKPPDQLIFEKEDSFGFGSNAKTVLINASGEERASHLQTT
DSQ  GAAACGACAAGCAAAATTCATTATCACGCCACGGCGAAAGGTAACCTCTCCATTCAGGACGCATCGGTTGATGGTAAATTCATCGTGATCGAAAATACCAGTCCAACA......---AAAGAGGAAAATATTGGTGAGTGGCAAATCAAAAGAAGTGCCGATAATGGA------CCGGAAGTGGTTTTTACGTTCCCAAAAGGATTCATCCTTAAACCACTCAAAACTGTTAAGATTTGGGCTCGTGATCAAGGCGGTGAGGATAAGCCTCCTGATCAGTTGATCTTTGAGAAGGAGGATTCGTTTGGCTTTGGCTCGAATGCCAAGACGGTCCTTATCAATGCGAGCGGAGAGGAACGTGCTAGTCACCTCCAAACCACA
TRN  10010101110011011
NAM  Q17048_9BILA/507-628
ASQ  ETSSRTSYTRSAKGNVSIQETSPDGKYIVLENTHRS..-KEEPIGEWKLKRKIDGK--KEIVYTLPKDFILKPCKHVKIWARGQGGIHAPPEQLIFEGEDSFGVGSNVQTILYNREGEERATHIQRS
DSQ  GAAACGTCATCGCGCACTTCATACACTCGATCCGCGAAGGGTAACGTATCGATCCAAGAAACATCGCCGGATGGCAAATATATTGTCCTCGAAAATACCCACCGTTCG......---AAAGAGGAACCGATCGGCGAATGGAAATTAAAACGAAAGATCGATGGGAAG------AAAGAAATCGTCTATACCCTTCCAAAGGATTTCATACTGAAACCTTGTAAACACGTCAAGATCTGGGCTCGAGGTCAAGGTGGAATCCACGCTCCACCCGAGCAGCTCATCTTCGAAGGAGAGGATTCATTCGGAGTGGGCAGCAACGTACAAACAATCCTCTACAACAGAGAAGGCGAGGAAAGAGCGACGCACATTCAGAGATCG
TRN  10010101100011000
NAM  AV71_ACAVI/269-389
ASQ  ETASRTSFQRSAKGNVSIQDAASDGKYILSENTHRS..-KEEPIGEWRLKRKIDGK--REIVYTFPTNFVLKPGKSVKIWARGQG-VYSPPDQLVFDAEDSFGIGSNVQTILFNKEGEERASHIQRS
DSQ  GAAACAGCGAGCCGTACGTCATTTCAACGTTCCGCAAAAGGCAATGTTTCCATACAGGATGCTGCGTCAGATGGTAAATACATTTTATCGGAGAACACGCATCGTTCC......---AAGGAAGAACCAATTGGTGAATGGAGATTGAAGCGGAAGATTGACGGCAAA------CGTGAAATTGTATACACTTTTCCAACAAATTTCGTTCTGAAACCCGGAAAATCGGTTAAGATTTGGGCTCGTGGCCAAGGA---GTGTACAGTCCACCTGATCAATTGGTTTTTGATGCGGAAGATTCGTTTGGAATTGGTTCTAATGTACAAACTATTCTCTTCAACAAAGAGGGAGAGGAACGTGCATCACACATTCAACGCTCA
TRN  10010101100011000
NAM  IFA1_CAEEL/452-572
ASQ  ETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRA..-KDEAIGEWKLKRRIDGK--RENVYTLPRDFVLRAGKTLKIFARNQG-VASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQ
DSQ  GAAACTGCATCCCGTCAATCGTTCCAGCGTTCTGCAAAGGGAAATGTTTCTATCCACGAGGCATCGCCGGATGGAAAGTTCATCGTCCTCCAGAACACACATCGTGCC......---AAGGACGAGGCTATCGGTGAGTGGAAGTTGAAGAGACGTATCGACGGAAAA------CGTGAGAATGTCTACACGCTTCCAAGAGACTTTGTCCTTCGTGCCGGAAAGACCCTCAAAATCTTCGCCCGTAACCAAGGA---GTTGCCTCACCACCAGATCAATTGGTCTATGATGCTGAAGACTCGTTCGGAAGCGGAAACAACGTCCAAACCATCCTCTTCAACAAAGAAGGAGAGGAACGTGCTACCCACATCCAACGCCAG
TRN  10010101110011001
NAM  IFA2_CAEEL/454-574
ASQ  EHSSRTSYQRSAKGNVAIKETSPEGKFVILENTHRA..-KEEPLGDWKLKRKIDGK--REIVFTFPSDYILHPFQSVKIFARGQG-IANPPEVLIFEGDETFGVGANVQTILYNNKGEERATHIQRQ
DSQ  GAACACTCCAGCAGAACATCTTATCAACGTTCAGCTAAAGGAAATGTGGCGATCAAGGAAACCTCCCCAGAAGGCAAATTTGTCATTTTGGAAAACACACACAGAGCC......---AAAGAAGAGCCACTCGGAGACTGGAAGCTTAAGAGAAAGATCGACGGAAAA------CGCGAGATCGTCTTCACCTTCCCATCCGACTACATCCTCCACCCATTCCAATCTGTCAAGATCTTCGCCCGCGGACAAGGA---ATCGCCAATCCTCCAGAAGTGCTCATTTTCGAAGGTGACGAAACATTCGGTGTTGGCGCCAACGTTCAAACAATCCTTTACAACAATAAGGGAGAGGAGCGCGCGACACACATCCAACGTCAA
TRN  10010101110011001
NAM  IFA4_CAEEL/453-572
ASQ  ETTSHSSYSRSAKGNIAIQEAEPSGKYIVLENISR-..-RDENIGDWKLRRKIAGK--REIVFTFPREFTLRAQKSVKIFARGQG-VHSPPDSLVYDLEDSFGTGNDVVTTLYNKEGEDRASHSQRA
DSQ  GAAACGACTAGTCATTCGTCGTATTCCAGATCAGCAAAAGGAAATATTGCAATTCAGGAAGCCGAGCCATCTGGAAAGTACATTGTACTGGAGAACATCTCAAGA---......---CGTGATGAGAACATCGGAGACTGGAAACTCCGTCGGAAGATTGCCGGAAAA------CGCGAAATCGTGTTCACCTTCCCGCGCGAGTTCACCCTTCGTGCTCAAAAGAGCGTGAAAATTTTCGCACGTGGGCAGGGA---GTTCATTCCCCACCCGATAGTCTTGTGTACGACCTCGAAGACTCGTTCGGCACCGGAAACGACGTCGTTACTACTCTCTACAACAAAGAAGGAGAGGACCGTGCTTCCCACAGCCAACGTGCT
TRN  10010101100011001
NAM  IFEB_ASCSU/463-584
ASQ  EVSTKTTFQRSAKGNVTISECDPNGKFITLENTHRS..-KDENLGEHRLKRKLDNR--REIVYTIPPNTVLKAGRTMKIYARDQGGIHNPPDTLVFDGENTWGIGANVVTSLINKDGDERATHTQKT
NAM  IFB2_CAEEL/417-538
ASQ  EVQTRSSFKRHAKGNVSIVECDPQGKYIILENTSGS..-VAEDVSNFEIRRVIDGVQ--AFVFRLPSHLVIQQHGHLKIYGRNSGGINSPPDSIVMESHPSWGQGGQVETFLYNSHGIEKASHIQTT
DSQ  GAGGTTCAAACTCGTTCCTCATTCAAGAGACACGCTAAGGGAAATGTGAGCATCGTTGAGTGCGATCCACAAGGAAAGTACATCATTCTTGAAAACACCAGTGGATCA......---GTTGCCGAAGATGTAAGCAACTTTGAAATCCGTCGTGTTATTGATGGAGTTCAA------GCCTTCGTTTTCCGTCTCCCATCTCACTTAGTTATTCAACAACACGGACATCTTAAGATCTACGGACGCAATTCAGGAGGAATTAACTCACCACCAGACTCAATTGTGATGGAATCTCACCCATCATGGGGACAAGGAGGACAAGTTGAAACATTCTTGTACAATAGTCACGGAATTGAGAAGGCTTCGCACATCCAGACGACG
TRN  10010101110011000
NAM  LAMC_DROME/465-582
ASQ  RTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGT-..-EEINLTGWQLTRIAGDEE---LAFKFSRGSKILGGASVTIWSVDAGTAHDPPNN--LVMKKKWPVANSMRSVLANADKEDVASYDRVR
DSQ  CGCACTCTGTCTGAGTACTCGGTGAATGCCGCCGCCAAGGGAGATCTGGAGATCATCGAGGCGGACGTTGAGGGACGCTTCATCAAGCTGCACAACAAGGGAACC---......---GAGGAGATCAATCTGACTGGCTGGCAGCTAACCCGCATTGCCGGCGACGAGGAA---------CTGGCCTTCAAGTTCTCGCGCGGATCGAAGATACTCGGCGGTGCTAGTGTCACCATTTGGTCCGTCGATGCCGGTACCGCACATGATCCACCCAACAAT------CTGGTGATGAAGAAGAAGTGGCCGGTGGCCAACTCGATGCGATCGGTGCTGGCCAATGCCGACAAAGAGGATGTTGCCAGCTACGACCGTGTCCGT
TRN  10010101100011011
NAM  LAM0_DROME/458-578
ASQ  HSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGS-..-EEVAIGGWQLQRLINEKG-PSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSS-LVMKSQKWVSADNTRTILLNSEGEAVANLDRIK
DSQ  CACAGCGTCGCCGATTACTATGTGTCCGCCAGTGCCAAGGGCAACGTGGAGATCAAGGAGATCGATCCCGAGGGCAAGTTCGTAAGGCTGTTCAACAAGGGCAGC---......---GAGGAGGTGGCCATCGGTGGCTGGCAGCTGCAGCGGCTAATCAACGAGAAAGGT---CCTTCGACCACTTACAAGTTCCATCGATCGGTGAGGATCGAGCCAAATGGCGTGATCACCGTTTGGTCGGCGGACACCAAGGCCTCGCACGAGCCGCCATCGAGC---CTTGTGATGAAGTCACAGAAGTGGGTCTCCGCCGACAACACTAGGACGATTTTGCTGAACTCCGAGGGCGAGGCCGTGGCCAATCTGGATCGCATCAAG
TRN  10010101100011001
NAM  LAMA_XENLA/422-542
ASQ  SRSSSFTQHARTTGKVSVEEVDPEGKYVRLRNKSN-..-EDQSLGNWQIKRQIGDETP--IVYKFPPRLTLKAGQTVTIWASGAGATNSPPSDLVWKAQSSWGTGDSIRTALLTSSNEEVAMRKLVR
DSQ  TCGCGGAGCAGCAGCTTCACCCAACACGCCCGCACCACCGGGAAAGTGTCAGTGGAAGAGGTGGATCCCGAGGGGAAATATGTCCGACTGAGGAACAAGAGTAAT---......---GAGGACCAATCGCTGGGGAACTGGCAGATCAAGCGTCAGATCGGGGACGAGACCCCC------ATTGTGTACAAGTTCCCTCCCAGACTTACACTAAAGGCCGGACAAACCGTAACGATTTGGGCATCAGGAGCTGGAGCCACAAATAGTCCCCCCAGTGATTTAGTGTGGAAGGCCCAGAGCTCTTGGGGAACAGGCGACAGTATTCGCACAGCTCTGCTCACATCAAGCAATGAGGAAGTTGCTATGAGGAAACTGGTGCGA
TRN  10010101100011000
NAM  LAMA_HUMAN/425-545
ASQ  ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSN-..-EDQSMGNWQIKRQNGDDPL--LTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVR
DSQ  GAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAAT---......---GAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTG------CTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGC
TRN  11011111101111101
NAM  LAMA_CHICK/426-546
ASQ  EGRTSFSHHARTSGRVGVEEVDLEGRFVRLRNKSN-..-EDQALGNWQVKRQNGDDPP--LTYRFPPKFTLKAGQAVTIWASGAGATHSPPSDVVWKAQSSWGSGDSLRTALINSNGEEVAMRKLVR
DSQ  GAGGGCCGCACGAGCTTCTCGCACCACGCCAGGACCAGCGGGAGGGTCGGCGTCGAGGAGGTGGACCTGGAGGGGCGCTTCGTCCGCCTCCGCAACAAATCCAAT---......---GAGGACCAGGCCCTGGGGAACTGGCAGGTGAAGCGGCAGAACGGGGACGACCCCCCC------CTGACGTACCGCTTCCCCCCGAAGTTCACTCTGAAGGCGGGTCAGGCGGTCACGATCTGGGCCTCGGGGGCCGGCGCGACCCACAGCCCCCCCAGCGATGTGGTGTGGAAGGCGCAGAGCTCGTGGGGCAGCGGGGACAGTCTGCGCACCGCCCTCATCAACTCCAACGGAGAGGAGGTGGCCATGCGGAAGTTGGTGCGC
TRN  10010101100011011
NAM  LAML2_XENLA/465-585
ASQ  TTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSD-..-KDQSLGNWRLKRKIGEEEE--IVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSSWGTGSNIRTYLVNTEEEEVAVRTVTK
DSQ  ACTACTCGATTTCACTTGTCCCAGCAGGCTTCGGCCACAGGAAGTATCAGTATTGAGGAGATTGATTTGGAAGGAAAATATGTCCACCTGAAAAATAACTCTGAT---......---AAGGACCAGTCCCTTGGTAACTGGAGGCTGAAGAGAAAAATTGGAGAGGAGGAGGAA------ATAGTTTACAAATTCACGCCTAAATATGTACTTAAAGCAGGGCAGTCTGTTAAGATATACAGTGCTGATGCTGGGGTGGCTCACAGCCCCCCTTCCATTCTAGTGTGGAAGAACCAGAGTTCCTGGGGTACAGGCAGCAACATTAGAACATACTTGGTTAACACTGAAGAGGAGGAAGTAGCTGTGAGAACAGTTACAAAA
TRN  10010101100011011
NAM  LAM2_CHICK/442-562
ASQ  SSSFQMSQQASATGSISIEEIDLEGKYVQLKNNSE-..-KDQSLGNWRLKRQIGDGEE--IAYKFTPKYVLRAGQTVTIWGADAGVSHSPPSVLVWKNQGSWGTGGNIRTYLVNSDGEEVAVRTVTK
DSQ  AGCAGTAGCTTCCAAATGTCCCAGCAAGCTTCAGCTACAGGAAGTATCAGCATTGAAGAGATAGACCTGGAGGGAAAATACGTTCAACTGAAGAACAACTCGGAG---......---AAGGATCAATCTTTGGGTAACTGGAGACTGAAAAGACAAATTGGAGATGGAGAAGAA------ATTGCTTACAAATTTACTCCGAAGTATGTCCTCAGGGCTGGGCAGACTGTAACAATCTGGGGTGCAGATGCAGGTGTGTCTCACAGCCCCCCTTCTGTTCTTGTGTGGAAGAATCAAGGCAGCTGGGGCACCGGAGGAAATATCCGCACATACCTCGTGAACTCTGATGGAGAGGAGGTTGCAGTGAGAACTGTTACTAAG
TRN  10010101100011001
NAM  LAM2_MOUSE/435-551
ASQ  SRLAQT----VATGVVNIDEVDPEGRFVRLKNSSD-..-KDQSLGNWRIKRQVLEGED--IAYKFTPKYVLRAGQTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVAVKAAKH
DSQ  TCCCGCCTGGCTCAGACT------------GTGGCCACGGGTGTTGTGAACATCGACGAGGTGGACCCAGAGGGCAGGTTCGTGCGCCTTAAGAACTCTTCAGAC---......---AAGGACCAGTCTTTGGGGAACTGGAGGATCAAGAGACAGGTTCTGGAGGGTGAGGAC------ATTGCCTACAAGTTCACACCCAAGTATGTCCTCCGGGCCGGCCAGACTGTCACGGTGTGGGCAGCTGGCGCAGGGGCTACCCACAGTCCCCCATCAACCCTTGTGTGGAAAAGCCAGACCAACTGGGGCCCTGGGGAGAGCTTCCGCACTGCCCTGGTCAGTGCCGACGGTGAGGAGGTGGCCGTGAAGGCTGCAAAGCAC
TRN  10010101100011001
NAM  LAML1_XENLA/426-545
ASQ  SSSVSIDHSAAATGDVSIEEVDVDGKYIRLKNNSE-..-KDHPLGGWELTRTIGEAS---VNFKFTSRYVLKAEQTVTIWAADAGVKASPPSDLIWKNQNSWGTGEDVKATLKNSQGEEVAQRTTIY
DSQ  AGCAGTAGTGTCAGCATTGATCATTCTGCGGCTGCTACTGGGGATGTGAGCATTGAAGAAGTTGATGTGGATGGCAAATATATCCGACTGAAAAACAATTCCGAG---......---AAGGATCATCCTTTAGGGGGTTGGGAATTGACCAGAACAATCGGAGAAGCTTCT---------GTGAATTTCAAGTTTACCTCAAGATATGTACTTAAAGCTGAACAGACTGTCACAATCTGGGCTGCTGATGCTGGAGTAAAAGCAAGTCCACCATCTGACCTAATCTGGAAGAATCAGAATTCATGGGGTACAGGAGAAGATGTGAAGGCCACACTGAAGAATTCTCAGGGAGAGGAAGTAGCACAGCGCACAACAATCTAT
TRN  10010101100011000
NAM  LAM1_CHICK/426-545
ASQ  SSSVSISHSASATGNISIEEIDVDGKFIRLKNTSE-..-QDQPMGGWEMIRKIGDTS---ASYRYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVVLKNSQGEEVAQRSTVF
DSQ  AGCAGTAGTGTCAGCATCTCCCATTCGGCTTCTGCCACTGGAAATATCTCTATTGAGGAGATAGATGTTGATGGAAAATTCATCCGCTTGAAGAATACCTCTGAA---......---CAGGATCAACCTATGGGAGGTTGGGAGATGATCAGAAAAATAGGAGACACTTCT---------GCTAGTTACAGATATACTTCAAGATATGTACTAAAGGCGGGACAGACTGTTACAATATGGGCTGCAAATGCTGGAGTAACTGCTAGCCCTCCCACTGACCTCATCTGGAAGAACCAGAATTCCTGGGGCACTGGTGAAGATGTGAAGGTTGTGCTGAAAAATTCTCAGGGGGAGGAAGTTGCTCAGAGAAGCACTGTCTTT
TRN  10010101100011001
NAM  LAML3_XENLA/426-546
ASQ  KRSYKVVQQASSTGPVSVEDIDPEGNYVRLLNNTE-..-EDFSLHGWVVKRMHMSLPE--IAFKLPCRFILKSSQRVTIWAAGAGAVHSPPTDLVWKSQKTWGTGDNIKITLLDSTGEECAERTLYR
DSQ  AAAAGGTCCTATAAAGTAGTTCAACAGGCCTCTTCCACAGGGCCAGTGTCTGTAGAAGATATTGACCCAGAAGGGAACTATGTCAGGCTGTTGAACAACACAGAA---......---GAGGATTTTTCTCTGCATGGATGGGTTGTTAAGAGAATGCATATGAGCCTTCCAGAA------ATTGCATTTAAACTTCCATGTCGCTTCATTTTGAAATCCAGTCAACGTGTCACTATCTGGGCTGCTGGTGCTGGTGCTGTACACAGTCCTCCCACCGATTTGGTCTGGAAATCTCAGAAGACTTGGGGAACAGGCGATAATATTAAAATCACTCTCCTTGATTCCACTGGTGAAGAATGCGCTGAGCGAACCCTTTATAGA
TRN  10010101100011011
NAM  LMN1_CAEEL/434-550
ASQ  NRRSKL--NKETVGPVGIDEVDEEGKWVRVANNSE-..-EEQSIGGYKLVVKAGNKE---ASFQFSSRMKLAPHASATVWSADAGAVHHPPEVYVMKKQQ-WPIGDNPSARLEDSEGDTVSSITVEF
DSQ  AACCGTCGCTCCAAACTC------AACAAAGAGACTGTTGGCCCAGTTGGAATCGACGAGGTTGATGAGGAAGGAAAGTGGGTCCGTGTTGCAAACAACTCTGAA---......---GAAGAACAATCCATCGGAGGATACAAGTTGGTGGTCAAAGCTGGAAACAAAGAA---------GCCTCCTTCCAATTTTCATCTCGTATGAAGCTCGCTCCACATGCTAGCGCCACCGTTTGGTCTGCGGATGCTGGTGCCGTTCACCACCCACCAGAAGTCTACGTTATGAAGAAGCAACAG---TGGCCAATTGGAGATAACCCATCAGCTCGTCTTGAGGATAGTGAAGGAGACACTGTTTCTTCTATCACCGTTGAATTC
TRN  11011101111011001
//