EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00862 - Sucrose_synth)
FAM  PF00862
PID  Sucrose_synth
DES  Sucrose synthase
IPR  IPR000368
ANO  4
ALN  551
AID  0.760978
APH  (SUSY_SOYBN/7-554:0.12267,(SUS2_TULGE/7-555:0.14031,SUS2_PEA/8-557:0.22198):0.03616,SUS1_DAUCA/7-556:0.12831);
ATP  (SUSY_SOYBN/7-554,(SUS2_TULGE/7-555,SUS2_PEA/8-557),SUS1_DAUCA/7-556);
ATL  0.64943
DNO  4
DLN  1653
DID  0.708631
DPH  (SUSY_SOYBN/7-554:14.96560,(SUS2_TULGE/7-555:18.33552,SUS2_PEA/8-557:34.19945):7.49024,SUS1_DAUCA/7-556:19.19253);
DTP  (SUSY_SOYBN/7-554,(SUS2_TULGE/7-555,SUS2_PEA/8-557),SUS1_DAUCA/7-556);
DTL  94.1693
RID  0.760978
RPH  (SUSY_SOYBN/7-554:0.12267,(SUS2_TULGE/7-555:0.14031,SUS2_PEA/8-557:0.22198):0.03616,SUS1_DAUCA/7-556:0.12831);
RTP  (SUSY_SOYBN/7-554,(SUS2_TULGE/7-555,SUS2_PEA/8-557),SUS1_DAUCA/7-556);
RTL  0.64943
LNK  SUS1_DAUCA/7-556:P49035:X75332
LNK  SUS2_PEA/8-557:O24301:AJ001071
LNK  SUS2_TULGE/7-555:Q41607:X96939
LNK  SUSY_SOYBN/7-554:P13708:AF030231
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SUS1_DAUCA/7-556
ASQ  TRVHSLRERMDSTLANHRNEILMFLSRIESHGKGILKPHQLLAEYEAIS.KEDKLKLDDGHGAFAEVIKSTQEAIVSPPWVALAIRLRPGVWEYVRVNVHHLVVEELSVPQYLQFKEELVIGSSDANFVLELDFAPFTASFPRPTLTKSIGNGVEFLNRHLSAKMFHGKDSMHPLLEFLRLHNYNGKTLMLNNRVQNVNGLQSMLRKAGDYLSTLPSDTPYSEFEHKFQEIGFERGWGDTAERVTEMFHMLLDLLEAPDASTLETFLGKIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDIKPRILIVTRLLPDAVGTTCNQRLEKVFGAEHAHILRVPFRTEKGILRKWISRFEVWPYIETFTEDVAKEIALELQAKPDLIIGNYSEGNLVASLLAHKLGVTQCTIAHALEKTKYPDSDIYWEKFDKKYHFSSQFTADLIAMNHTDFIITSTFQEIAGSKDTVGQYESHTAFTMPGLYRVVHGIDVFDPKFNIVSPGADTSVYFSYKEKEKRLTTLHPEIEELLYS
DSQ  ACCCGAGTTCACAGCCTCCGGGAACGTATGGATTCAACTTTGGCCAATCATCGCAATGAAATCTTGATGTTTCTATCAAGGATTGAAAGTCATGGAAAAGGAATCTTGAAACCTCACCAGCTTCTAGCTGAGTATGAAGCTATCAGC...AAAGAAGACAAGCTGAAACTGGACGATGGTCATGGCGCCTTCGCGGAAGTTATTAAGTCTACCCAGGAAGCCATAGTTTCTCCTCCATGGGTAGCACTTGCTATTCGGCTCAGACCTGGTGTGTGGGAATATGTAAGAGTCAACGTGCATCACCTTGTCGTCGAGGAATTGAGTGTGCCTCAGTATCTTCAATTTAAAGAGGAGCTTGTCATTGGATCAAGCGATGCAAACTTTGTCCTTGAACTCGATTTTGCACCATTCACCGCCTCTTTCCCTCGTCCAACACTTACCAAGTCTATAGGGAATGGAGTTGAGTTTCTCAACAGGCATCTTTCTGCAAAAATGTTTCATGGCAAGGACAGCATGCACCCACTTCTTGAGTTTCTCCGGCTCCACAACTACAATGGCAAGACCCTGATGCTGAACAACAGAGTTCAGAATGTGAATGGTCTCCAATCTATGCTGAGGAAAGCTGGGGATTATCTCTCTACACTACCATCAGACACACCTTACTCTGAATTTGAGCACAAGTTCCAAGAGATTGGTTTTGAGAGGGGTTGGGGTGATACTGCCGAGCGTGTTACTGAGATGTTTCACATGCTTCTGGACCTTCTTGAGGCCCCTGATGCATCCACTCTTGAGACATTTTTGGGGAAAATTCCAATGGTTTTCAATGTTGTTATTCTCTCCCCTCATGGTTACTTTGCTCAAGAGAATGTTTTGGGATATCCCGACACTGGTGGCCAGGTTGTCTACATTTTGGATCAAGTTCCTGCATTGGAGCGTGAGATGATTAAGCGCATAAAGGAGCAAGGACTCGACATCAAGCCTCGTATTCTGATTGTAACACGCCTTCTGCCGGATGCAGTAGGTACCACTTGCAATCAGCGCCTGGAGAAAGTGTTTGGAGCTGAACACGCCCATATTCTTAGAGTCCCCTTTAGAACTGAGAAAGGAATTTTGCGCAAATGGATCTCCCGCTTTGAAGTTTGGCCCTACATTGAGACTTTCACTGAGGATGTTGCAAAAGAAATTGCCTTGGAGTTGCAGGCCAAGCCAGATCTGATTATTGGAAACTATAGCGAGGGTAATCTTGTTGCATCCTTGCTGGCACACAAATTAGGTGTTACCCAGTGTACCATTGCTCATGCTTTAGAGAAAACAAAGTACCCTGATTCCGACATCTACTGGGAGAAATTTGACAAGAAGTATCACTTTTCCAGTCAGTTTACAGCCGATCTTATTGCAATGAATCATACTGATTTCATCATCACCAGCACATTCCAGGAGATAGCTGGAAGTAAGGATACTGTTGGACAGTATGAGAGTCATACTGCCTTTACAATGCCCGGATTGTACCGAGTTGTGCATGGGATAGATGTCTTCGACCCAAAATTCAACATCGTTTCACCAGGTGCAGACACATCTGTTTATTTCTCTTACAAAGAGAAGGAAAAGAGGCTGACAACACTTCACCCTGAAATTGAGGAACTTCTTTACAGT
TRN  10010101100011000
NAM  SUSY_SOYBN/7-554
ASQ  TRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIP.EENRQKLTD--GAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEYLHFKEELVDGSSNGNFVLELDFEPFNAAFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLEFLRLHSVKGKTLMLNDRIQNPDALQHVLRKAEEYLGTVPPETPYSEFEHKFQEIGLERGWGDNAERVLESIQLLLDLLEAPDPCTLETFLGRIPMVFNVVILSPHGYFAQDNVLGYPDTGGQVVYILDQVRALENEMLHRIKQQGLDIVPRILIITRLLPDAVGTTCGQRLEKVFGTEHSHILRVPFRTEKGIVRKWISRFEVWPYLETYTEDVAHELAKELQGKPDLIVGNYSDGNIVASLLAHKLGVTQCTIAHALEKTKYPESDIYWKKLEERYHFSCQFTADLFAMNHTDFIITSTFQEIAGSKDTVGQYESHTAFTLPGLYRVVHGIDVFDPKFNIVSPGADQTIYFPHTETSRRLTSFHPEIEELLYS
DSQ  ACCCGGGTTCACAGTCTCCGTGAGAGGCTTGATGAAACCCTCACTGCCAACAGGAATGAAATTTTGGCCCTTCTGTCAAGGATCGAAGCCAAGGGCAAGGGCATCCTGCAACACCACCAGGTCATTGCTGAGTTTGAGGAAATCCCT...GAGGAGAACAGACAGAAGCTCACTGAT------GGTGCCTTTGGAGAAGTCTTGAGATCTACACAGGAAGCCATAGTTTTGCCACCATGGGTTGCTCTGGCTGTTCGTCCAAGACCTGGTGTGTGGGAGTACCTGAGAGTGAATGTGCACGCTCTTGTTGTTGAGGAGTTGCAACCTGCTGAGTACCTGCACTTCAAGGAAGAACTTGTTGACGGAAGTTCTAATGGCAACTTTGTGCTTGAGTTGGACTTTGAACCATTCAATGCAGCCTTCCCCCGCCCAACTCTTAACAAGTCAATTGGAAATGGTGTGCAATTCCTCAACCGTCACCTTTCTGCCAAACTCTTCCACGACAAGGAGAGCTTGCACCCACTTTTGGAGTTCCTCAGGCTTCACAGCGTCAAGGGAAAGACTTTGATGTTGAATGACAGAATTCAAAACCCAGATGCACTCCAACATGTTCTGAGGAAAGCTGAGGAGTATCTGGGCACAGTGCCTCCTGAAACTCCCTACTCAGAATTTGAGCACAAGTTCCAGGAGATTGGTTTGGAGAGAGGGTGGGGTGACAACGCGGAGCGTGTCCTTGAGTCAATTCAACTTCTCTTGGATCTTCTTGAGGCCCCTGACCCGTGCACCCTTGAGACTTTCCTTGGAAGAATCCCTATGGTGTTCAATGTTGTTATTCTTTCTCCCCATGGTTACTTTGCCCAAGATAATGTCTTGGGATACCCTGACACTGGTGGCCAGGTTGTTTACATCTTGGATCAAGTTCGTGCTTTGGAGAATGAGATGCTCCATCGCATTAAGCAACAAGGATTGGACATTGTTCCTCGTATTCTCATTATCACCCGTCTTCTCCCCGATGCAGTAGGAACTACTTGTGGCCAACGTCTTGAGAAGGTGTTCGGAACTGAGCACTCCCACATTCTTCGAGTTCCCTTTAGAACTGAGAAGGGAATTGTTCGCAAGTGGATCTCAAGATTCGAAGTCTGGCCCTACTTGGAAACTTACACTGAGGATGTTGCCCACGAGCTTGCCAAAGAGTTGCAAGGCAAGCCAGATCTGATTGTTGGAAACTACAGTGATGGAAACATTGTCGCTTCTTTGTTGGCACATAAATTAGGTGTCACTCAGTGTACCATTGCTCACGCACTTGAGAAGACCAAATACCCCGAATCCGACATTTACTGGAAAAAATTGGAAGAGAGATACCACTTCTCTTGCCAATTCACAGCTGATCTATTTGCCATGAACCACACAGATTTCATTATCACCAGTACCTTCCAGGAGATTGCTGGAAGCAAGGACACTGTTGGACAGTACGAATCTCACACAGCCTTCACCCTTCCTGGACTCTACCGCGTTGTGCATGGTATTGATGTCTTTGATCCAAAATTCAACATTGTCTCCCCTGGAGCTGATCAAACCATTTACTTCCCCCACACTGAAACCAGCCGTAGGTTGACATCCTTCCACCCTGAAATCGAAGAACTCCTTTACAGC
TRN  10010101100011000
NAM  SUS2_TULGE/7-555
ASQ  TRVHSVRERLTDTLSAHKNELLALFSRFVKQGQGMLQPHQLLTEYEAVIpAADREKLKD--GVFEDVLKAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFKEELVDGSGQSNFTLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLLNFLKEHHYNGTSMMLNDRIQTLGALQASLRRADEYVLSLPLDTPYSDFGHRFQELGLEKGWGDNAKRVHENLHLLLDLLEAPDPCTLENFLGTIPMVFNVVILSPHGYFAQANVLGYPDTGGQVVYILDQVRAMESEMLLRIKQQGLDITPRILIVTRLLPDAVGTTCGQRLEKVLGTEHTHILRVPFRTEHGILRKWISRFEVWPYLETYAEDVANEVAGELQATPDLIIGNYSDGNLVASLMAHKLGVTQCTIAHALEKTKYPNSDLYWKKFEKQYHFSCQFTADLIAMNHADFIITSTFQEIAGSKDTVGQYESHTGFTLPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYTEAEKRLTALHPEIEELLYS
DSQ  ACCCGCGTCCATAGCGTGAGGGAGCGATTGACTGATACACTCTCTGCCCACAAGAATGAACTGTTGGCTCTCTTCTCAAGGTTTGTTAAGCAGGGTCAAGGAATGCTTCAGCCCCATCAGCTGCTCACTGAGTATGAAGCAGTGATAccgGCAGCCGACAGAGAGAAGCTGAAGGAT------GGGGTCTTTGAGGATGTACTGAAGGCTGCACAGGAGGCCATTGTCATCCCTCCATGGGTCGCTCTGGCGATTCGCCCGCGGCCTGGCGTGTGGGAATACGTACGGGTAAATGTGAGCGAGCTTGCTGTGGAGGAGCTGACTGTGCCTGAATACCTTCAGTTCAAGGAGGAACTCGTTGATGGCAGTGGCCAAAGCAATTTTACACTTGAGCTTGATTTTGAACCCTTCAATGCCTCTTTTCCCCGTCCTTCGCTCTCAAAATCGATTGGCAATGGAGTGCAGTTCCTTAATCGTCACCTTTCTTCGAAACTATTTCACGACAAGGAAAGCATGTACCCGCTGCTTAATTTCCTCAAGGAACATCACTACAATGGAACGTCGATGATGCTTAATGATAGAATTCAAACCCTTGGTGCTCTTCAAGCTTCACTAAGGAGGGCAGACGAATATGTACTGAGCCTCCCTCTAGACACCCCATACTCCGATTTCGGTCACAGATTTCAAGAGCTTGGTTTGGAGAAAGGTTGGGGGGATAATGCTAAGCGCGTCCACGAGAACCTTCATCTCCTTCTTGATCTCCTTGAGGCGCCTGATCCATGTACCTTGGAGAACTTCCTTGGAACTATTCCTATGGTGTTTAATGTTGTGATTCTATCTCCACATGGATATTTTGCACAGGCTAATGTTTTGGGGTACCCTGACACCGGTGGCCAGGTTGTTTATATTCTGGACCAAGTTCGTGCTATGGAGAGTGAAATGCTTCTTCGAATTAAGCAGCAGGGTCTTGATATCACACCCCGAATCCTAATTGTAACCAGATTGCTTCCTGACGCAGTAGGTACTACTTGCGGCCAGCGTCTTGAGAAGGTCCTTGGAACCGAGCACACGCACATTCTTAGGGTTCCGTTTAGAACTGAGCACGGAATTCTCCGTAAATGGATCTCACGATTTGAAGTATGGCCTTACCTAGAGACTTATGCAGAGGATGTTGCAAATGAGGTAGCAGGAGAGTTGCAGGCCACCCCAGATCTTATAATTGGAAACTATAGTGATGGGAATCTAGTTGCATCCTTAATGGCGCATAAATTAGGAGTTACTCAGTGCACCATTGCGCATGCATTGGAGAAAACTAAGTACCCAAATTCTGATCTGTACTGGAAAAAATTTGAGAAGCAGTATCACTTCTCTTGCCAATTCACTGCTGATCTAATCGCAATGAACCACGCTGACTTCATTATCACTAGCACCTTCCAAGAGATTGCTGGAAGTAAGGACACTGTTGGGCAATACGAATCTCACACTGGATTCACCCTTCCTGGACTTTACCGGGTTGTTCACGGGATCGATGTCTTCGACCCAAAGTTCAACATTGTATCCCCGGGAGCTGATATGTCCATATACTTCCCGTACACAGAGGCTGAGAAAAGGCTCACAGCCCTCCATCCAGAAATTGAGGAGCTGCTCTACAGT
TRN  10010101100011000
NAM  SUS2_PEA/8-557
ASQ  TRVPSIRDRVQDTLSAHRNELISLLSRYVAQGKGILQPHNLIDELDNIL.GEDHATLDLKNGPFGQIINSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVFELSVEQLSVSEYLSFKEELVEGKSNDNIILELDLEPFNASFPRPTRSSSIGNGVQFLNRHLSSNMFRNKDCLEPLLDFLRVHTYKGHALMLNDRIQSISKLQSALVKAEDHLSKLAPDTLYSEFEYELQGTGFERGWGDTAARVLEMMHLLLDILQAPDPSTLETFLGRVPMVFNVVILSPHGFFGQANVLGLPDTGGQVVYILDQVRALESEMLVRIKKQGLDFTPRILIVTRLIPDAKGTTCNQRLERVSGTEYTHILRVPFRSEKGILRKWISRFDVWPFLETFAEDVASEIAAELQCYPDFIIGNYSDGNLVASLLAYKMGVTQCTIAHALEKTKYPDSDIYWKKFEDKYHFSCQFTADLIAMNNADFIITSTYQEIAGTKNTIGQYESHTAFTLPGLYRVVHGIDVFDPKFNIVSPGADMTIYFPYSDKEKRLTALHSSIEKLLYG
DSQ  ACTCGAGTTCCCAGTATCAGAGACAGAGTTCAAGATACTCTCTCTGCTCATCGTAACGAACTCATTTCTCTTCTCTCCAGATATGTTGCTCAGGGGAAAGGGATTTTGCAACCGCATAATTTGATTGATGAACTTGATAATATACTT...GGCGAGGATCATGCAACACTGGATCTTAAAAATGGTCCATTTGGCCAAATTATCAACTCTGCACAGGAAGCCATAGTTTTGCCTCCTTTTGTGGCAATAGCAGTTCGTCCCAGACCAGGTGTTTGGGAGTATGTCCGTGTTAATGTCTTTGAACTCAGTGTGGAGCAGTTGAGTGTTTCTGAATATCTCAGCTTCAAAGAAGAACTTGTAGAAGGAAAGAGTAATGATAACATTATATTGGAGCTTGACCTTGAGCCATTTAATGCATCATTTCCCCGTCCAACTCGCTCGTCTTCCATTGGGAACGGTGTGCAGTTTCTCAACCGCCACCTCTCGTCAAATATGTTCCGTAACAAAGATTGCTTGGAACCCTTGCTTGATTTCCTCCGTGTTCACACATATAAAGGCCATGCACTGATGTTAAATGATAGAATACAAAGCATTTCCAAACTTCAGTCTGCTTTGGTCAAGGCTGAGGATCATCTTTCTAAGCTTGCGCCTGATACACTCTATTCTGAGTTTGAATATGAATTACAAGGAACGGGGTTCGAGAGAGGTTGGGGTGATACTGCTGCTCGGGTTTTAGAGATGATGCATCTTCTATTGGATATTCTTCAGGCTCCTGATCCTTCTACACTAGAGACTTTTCTTGGAAGAGTGCCTATGGTGTTCAATGTTGTTATATTGTCTCCACATGGCTTCTTTGGGCAAGCAAATGTCCTCGGCTTGCCTGACACTGGTGGCCAGGTTGTTTATATACTAGATCAAGTGCGGGCCCTTGAGAGTGAGATGCTAGTTCGGATCAAGAAACAAGGACTTGATTTCACTCCTAGAATTCTAATTGTTACTAGGTTAATACCTGATGCAAAGGGGACAACATGCAACCAGCGACTCGAAAGAGTCAGTGGCACTGAATACACACATATTTTGCGTGTTCCATTCCGATCAGAAAAAGGAATTCTTCGTAAATGGATCTCAAGGTTTGATGTCTGGCCTTTCCTGGAAACTTTTGCAGAGGATGTTGCCAGTGAAATTGCTGCCGAGTTACAATGTTATCCCGATTTCATCATAGGAAACTACAGTGATGGGAATCTCGTTGCATCTTTATTGGCTTACAAAATGGGAGTTACCCAGTGCACAATCGCGCATGCATTGGAGAAGACAAAGTATCCAGATTCAGATATATATTGGAAGAAATTCGAAGATAAATACCATTTTTCTTGTCAGTTCACTGCTGATCTAATAGCCATGAACAATGCTGATTTTATCATCACCAGTACATACCAAGAGATTGCTGGAACGAAGAATACTATTGGCCAGTATGAGAGTCACACTGCTTTTACTCTTCCGGGACTGTATAGAGTTGTCCACGGCATTGATGTTTTTGATCCCAAGTTCAACATTGTCTCTCCTGGAGCAGATATGACAATATATTTTCCATACTCTGATAAGGAGAAAAGACTCACGGCCCTACACAGTTCAATTGAAAAGCTATTATACGGT
TRN  10010101100011000
//