EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00859 - CTF_NFI)
FAM  PF00859
PID  CTF_NFI
DES  CTF/NF-I family transcription modulation region
IPR  IPR000647
ANO  3
ALN  300
AID  0.577811
APH  (Q91800_XENLA/210-501:0.12689,NFIC_HUMAN/217-508:0.07206,NFIB_CHICK/209-497:0.85147);
ATP  (Q91800_XENLA/210-501,NFIC_HUMAN/217-508,NFIB_CHICK/209-497);
ATL  1.05042
DNO  3
DLN  900
DID  0.594513
DPH  (Q91800_XENLA/210-501:0.14524,NFIC_HUMAN/217-508:0.22027,NFIB_CHICK/209-497:0.58488);
DTP  (Q91800_XENLA/210-501,NFIC_HUMAN/217-508,NFIB_CHICK/209-497);
DTL  0.95039
RID  0.577811
RPH  (Q91800_XENLA/210-501:0.12689,NFIC_HUMAN/217-508:0.07206,NFIB_CHICK/209-497:0.85147);
RTP  (Q91800_XENLA/210-501,NFIC_HUMAN/217-508,NFIB_CHICK/209-497);
RTL  1.05042
LNK  NFIB_CHICK/209-497:P17924:X51485
LNK  NFIC_HUMAN/217-508:P08651:X12492
LNK  Q91800_XENLA/210-501:Q91800:L43149
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q91800_XENLA/210-501
ASQ  QESFVTSGVFSVTELIQVSRTPVVSGTGPNFSLGELQGHLAYDLNPTGTGMRRTLPSTSSSGSKRHKSGSMEDDIDTSPGGEYYTSPSSPTGSNRNWTEDVEGGMSPTVKKSELDKSPFHSPSPQDISPRISSFTQHHRP---VIAVHSGLARSPHTSTTLHFPTSSLLPQ-ASTYFPHTAIRYPPHLNPQDPLKDLVSLACETSSQQPGPLNGSGQVKVSSHYISTQMLAPPPPGMPRLSLSSDTKSTTASDGSTSSPTSPTYSAPSTPPTNRSFVGLGPREPGSIYQAQS----WYLG
DSQ  CAGGAAAGCTTCGTCACTTCTGGAGTTTTCAGCGTCACAGAATTAATTCAAGTGTCTAGAACCCCAGTTGTGTCCGGCACAGGCCCAAATTTCTCTCTGGGAGAGCTACAGGGACACCTGGCATATGATTTAAACCCCACAGGCACTGGGATGAGGAGGACACTCCCCAGTACATCATCTAGTGGGAGTAAGCGGCACAAATCTGGCTCTATGGAAGATGACATTGATACCAGCCCTGGGGGAGAATACTACACATCACCCTCATCACCGACTGGAAGCAACCGAAATTGGACAGAAGATGTGGAAGGTGGAATGTCTCCCACTGTGAAGAAATCTGAATTGGACAAATCACCATTTCACAGTCCATCTCCTCAGGACATTTCACCAAGAATTAGTAGCTTTACTCAGCACCACAGGCCA---------GTTATTGCTGTTCACAGTGGTCTTGCTCGCAGTCCCCATACCTCCACTACTTTGCACTTTCCCACCTCTTCTCTCCTCCCCCAG---GCTTCCACCTACTTTCCTCACACTGCAATCCGGTATCCCCCCCACCTTAATCCACAGGACCCCCTTAAAGATTTGGTGTCCCTTGCCTGTGAGACCTCTAGCCAACAGCCTGGCCCGCTAAATGGGAGCGGTCAGGTGAAGGTTTCGAGTCACTATATCTCCACGCAGATGTTGGCCCCACCTCCTCCTGGAATGCCTCGTCTTTCTTTATCATCTGACACCAAATCTACAACTGCATCTGATGGCAGCACCTCCTCACCAACATCTCCAACATACTCTGCCCCCAGTACACCACCAACCAACCGATCATTTGTGGGACTTGGACCCCGTGAACCTGGGAGCATATATCAGGCACAATCC------------TGGTACCTTGGA
TRN  10010101100011000
NAM  NFIC_HUMAN/217-508
ASQ  QESFVTSGVFSVTELIQVSRTPVVTGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQD-SPRLSSFTQHHRP---VIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVGLGPRDPAGIYQAQS----WYLG
DSQ  CAGGAGAGCTTTGTCACCTCCGGCGTGTTCAGCGTCACTGAGCTCATCCAAGTGTCCCGGACACCCGTGGTGACTGGAACAGGACCCAACTTCTCCCTGGGGGAGCTGCAGGGGCACCTGGCATACGACCTGAACCCAGCCAGCACTGGCCTCAGAAGAACGCTGCCCAGCACCTCCTCCAGTGGGAGCAAGCGGCACAAATCGGGCTCGATGGAGGAAGACGTGGACACGAGCCCTGGCGGCGATTACTACACTTCGCCCAGCTCGCCCACGAGTAGCAGCCGCAACTGGACGGAGGACATGGAAGGAGGCATCTCGTCCCCGGTGAAGAAGACAGAGATGGACAAGTCACCATTCAACAGCCCGTCCCCCCAGGAC---TCTCCCCGCCTCTCCAGCTTCACCCAGCACCACCGGCCC---------GTCATCGCCGTGCACAGCGGGATCGCCCGGAGCCCACACCCGTCCTCCGCTCTGCATTTCCCTACGACGTCCATCCTACCCCAGACGGCCTCCACCTACTTCCCCCACACGGCCATCCGCTACCCACCTCATCTCAACCCCCAGGACCCGCTCAAAGATCTTGTCTCGCTGGCCTGCGACCCAGCCAGCCAGCAACCTGGACCGTTAAATGGAAGTGGTCAGCTCAAAATGCCCAGCCACTGCCTTTCTGCTCAGATGCTGGCACCTCCGCCCCCGGGGCTGCCACGGCTGGCGCTCCCCCCTGCCACCAAACCCGCCACCACCTCCGAGGGAGGAGCCACGTCGCCGACCTCGCCTTCCTACTCTCCGCCCGACACGTCCCCTGCAAACCGTTCCTTTGTGGGATTAGGACCAAGGGATCCTGCGGGCATTTATCAGGCACAGTCC------------TGGTATCTGGGA
TRN  10010101100011000
NAM  NFIB_CHICK/209-497
ASQ  EDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGELPSQPYYHDMNSGINLQRSLSSPPSS--KRPKTISIDENMEPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTMKKP--EKPLFSPTSPQDSSPRLSTFPQHHHPGIPGVAQSVISTRTPPSPSPLPFPAQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVP-SYDPSSPQTSQPNSSGQVVGKVPGHFTPVLAPSP---HHSAVRPVTLTMTDTKPITTS--TEAYTASGTSQANR-YVGLSPRDPSFLHQQQLRICDWTMN
DSQ  GAGGACAGTTTTGTAAAATCTGGAGTGTTCAACGTGTCAGAACTTGTGAGAGTGTCCAGAACACCTATAACCCAAGGAACTGGAGTGAACTTCCCAATTGGAGAACTTCCGAGCCAGCCGTACTACCATGATATGAATTCTGGTATAAATCTGCAGAGGTCTTTATCCTCTCCACCAAGCAGC------AAAAGACCCAAAACTATCTCCATAGATGAGAATATGGAGCCAAGCCCGACAGGAGACTTTTATCCTTCTCCAAATTCACCAGCTGCGGGAAGTCGGACATGGCATGAAAGAGATCAAGATATGTCTTCTCCTACAATGAAGAAACCT------GAAAAGCCTTTGTTTAGTCCTACTTCTCCCCAGGATTCTTCACCAAGACTGAGCACTTTCCCCCAGCATCACCACCCAGGAATCCCAGGAGTTGCACAGAGTGTCATCTCAACTAGAACTCCACCTTCACCTTCACCATTGCCATTTCCAGCACAAGCTATTCTCCCTCCAGCCCCGTCTAGTTACTTCTCTCATCCAACGATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAGAATTATGTACCT---TCTTACGACCCGTCCAGTCCACAGACTAGCCAGCCTAACAGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTTACTCCAGTTTTGGCACCCTCTCCC---------CATCACAGTGCGGTGCGACCTGTGACCCTGACCATGACAGATACTAAGCCCATCACTACATCC------ACTGAAGCCTACACAGCTTCAGGCACATCCCAAGCCAATCGA---TATGTGGGACTAAGCCCAAGAGACCCATCCTTCCTACACCAGCAACAGCTGAGGATTTGTGACTGGACCATGAAT
TRN  10010101100011000
//