EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00832 - Ribosomal_L39)
FAM  PF00832
PID  Ribosomal_L39
DES  Ribosomal L39 protein
IPR  IPR000077
ANO  10
ALN  43
AID  0.552416
APH  (RL39_KLUMA/8-50:0.21207,((RL39_RAT/8-50:0.17465,RL39_ARATH/9-51:0.16326):0.04008,RL39_DROME/9-51:0.09921):0.03886,((((RL39_METJA/9-51:0.30518,RL39_METTH/9-51:0.14714):0.13963,RL39_ARCFU/8-50:0.42249):0.05523,(RL39_SULAC/8-50:0.41196,RL39_HALMA/7-49:0.51037):0.12593):0.46166,RL39_SCHPO/8-50:0.12741):0.07521);
ATP  (RL39_KLUMA/8-50,((RL39_RAT/8-50,RL39_ARATH/9-51),RL39_DROME/9-51),((((RL39_METJA/9-51,RL39_METTH/9-51),RL39_ARCFU/8-50),(RL39_SULAC/8-50,RL39_HALMA/7-49)),RL39_SCHPO/8-50));
ATL  3.51034
DNO  9
DLN  129
DID  0.561585
DPH  (((((((RL39_ARATH/9-51:0.24359,RL39_DROME/9-51:0.13448):0.06832,RL39_SCHPO/8-50:0.22905):0.09369,RL39_KLUMA/8-50:0.16164):0.06383,RL39_RAT/8-50:0.23713):0.16834,RL39_SULAC/8-50:0.55799):0.10499,RL39_HALMA/7-49:0.44048):0.04425,RL39_METTH/9-51:0.26523,RL39_ARCFU/8-50:0.23209);
DTP  (((((((RL39_ARATH/9-51,RL39_DROME/9-51),RL39_SCHPO/8-50),RL39_KLUMA/8-50),RL39_RAT/8-50),RL39_SULAC/8-50),RL39_HALMA/7-49),RL39_METTH/9-51,RL39_ARCFU/8-50);
DTL  3.0451
RID  0.563535
RPH  ((((((RL39_DROME/9-51:0.09822,(RL39_RAT/8-50:0.17323,RL39_ARATH/9-51:0.16377):0.04259):0.04889,RL39_SCHPO/8-50:0.19722):0.05101,RL39_KLUMA/8-50:0.16204):0.35464,RL39_SULAC/8-50:0.49909):0.16959,RL39_METTH/9-51:0.25148):0.00772,RL39_HALMA/7-49:0.53594,RL39_ARCFU/8-50:0.40272);
RTP  ((((((RL39_DROME/9-51,(RL39_RAT/8-50,RL39_ARATH/9-51)),RL39_SCHPO/8-50),RL39_KLUMA/8-50),RL39_SULAC/8-50),RL39_METTH/9-51),RL39_HALMA/7-49,RL39_ARCFU/8-50);
RTL  3.208
LNK  RL39_ARATH/9-51:P51424:AY057730
LNK  RL39_ARCFU/8-50:O28212:AE000961
LNK  RL39_DROME/9-51:O16130:AE003462
LNK  RL39_HALMA/7-49:P22452:X55007
LNK  RL39_KLUMA/8-50:P48536:S53434
LNK  RL39_METJA/9-51:P54056:
LNK  RL39_METTH/9-51:O27650:AE000920
LNK  RL39_RAT/8-50:P62893:X82551
LNK  RL39_SCHPO/8-50:P05767:AL031307
LNK  RL39_SULAC/8-50:P13005:X16161
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RL39_KLUMA/8-50
ASQ  IKQKLAKAKNQNRPLPQWFRLKTNNTIRYNAKRRHWRRTKLVC
DSQ  ATCAAGCAGAAGTTGGCTAAGGCTAAGAACCAAAACAGACCATTGCCACAATGGTTCAGATTGAAGACCAACAACACTATCCGTTACAACGCTAAGAGAAGACACTGGAGAAGAACTAAGTTGGTTTGT
TRN  10110101110011011
NAM  RL39_DROME/9-51
ASQ  IKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL
DSQ  ATAAAGCAGAAGCTGGCTAAGAAGCTGAAGCAGAACAGATCCGTTCCCCAATGGGTTCGCCTACGTACTGGCAACACTATTCGTTACAACGCTAAGCGCCGTCACTGGAGGCGTACCAAGTTGAAGCTG
TRN  10010101100011011
NAM  RL39_ARATH/9-51
ASQ  IKKKLGKKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF
DSQ  ATTAAGAAGAAGTTGGGAAAGAAGATGAGACAGAACAGGCCTATTCCTCACTGGATTCGTCTTCGTACCGACAACACCATCAGGTACAATGCCAAGCGCAGGCACTGGCGTAGAACCAAGCTCGGATTC
TRN  10010101110011011
NAM  RL39_SCHPO/8-50
ASQ  TKQKLAKAARQNRPIPQWIRLRTGNTVHYNMKRRHWRRTKLNI
DSQ  ACCAAGCAAAAGCTTGCCAAGGCTGCGCGTCAAAACCGCCCCATTCCTCAATGGATTCGTCTTCGCACCGGAAACACTGTTCATTATAACATGAAGAGAAGACACTGGAGACGTACCAAGTTGAACATC
TRN  10010101110011011
NAM  RL39_RAT/8-50
ASQ  IKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
DSQ  ATCAAGCGATTCCTGGCAAAGAAACAAAAGCAAAATCGTCCTATTCCTCAATGGATTCGGATGAAAACTGGTAACAAAATCAGGTACAACTCTAAGAGAAGACACTGGAGGAGAACGAAGCTGGGTCTA
TRN  10010101100011011
NAM  RL39_HALMA/7-49
ASQ  TKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE
DSQ  ACGAAGAAGCGACTGGCCAAACTCGACAACCAGAACAGTCGAGTCCCGGCCTGGGTCATGCTCAAGACGGACCGCGAGGTCCAGCGCAACCACAAACGACGCCACTGGCGGCGCAACGACACTGACGAA
TRN  11011101101011011
NAM  RL39_SULAC/8-50
ASQ  KKLRLGKALKRNSPIPAWVIIKTQAEIRFNPLRRNWRRNNLKV
DSQ  AAAAAATTGAGACTAGGTAAAGCGTTAAAAAGAAACTCTCCTATTCCTGCTTGGGTCATAATAAAAACTCAAGCTGAGATAAGGTTTAATCCACTAAGAAGAAATTGGAGAAGAAATAATTTAAAGGTG
TRN  10010101110011010
NAM  RL39_ARCFU/8-50
ASQ  VKKRLAKAYKQNRRAPVWITVKTKRSVFGSPKRRHWRRSKLKV
DSQ  GTTAAGAAGAGGCTGGCGAAGGCCTACAAGCAAAACAGAAGAGCTCCCGTCTGGATTACTGTGAAGACCAAGAGGAGCGTCTTCGGAAGCCCCAAGAGGAGGCACTGGAGGAGGAGCAAGCTGAAGGTG
TRN  10010101100011011
NAM  RL39_METTH/9-51
ASQ  RKLRMAKANRQNRRVPAWVMVKTNYRVRSHPKMRHWRRTKLKV
DSQ  AGGAAACTCAGAATGGCAAAGGCTAACAGACAGAACAGAAGGGTGCCCGCATGGGTTATGGTTAAGACAAACTACAGGGTTCGAAGCCATCCAAAGATGAGGCACTGGAGAAGGACCAAACTCAAGGTA
TRN  10010101110011011
NAM  RL39_METJA/9-51
ASQ  KKVRLAKALKQNRRVPLFVIVKTRGRVRFHPKMRYWRRKKLKA
//