EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00802 - Glycoprotein_G)
FAM  PF00802
PID  Glycoprotein_G
DES  Pneumovirus attachment glycoprotein G
IPR  IPR000925
ANO  4
ALN  261
AID  0.415506
APH  (VGLG_ORSVW/10-251:0.32681,VGLG_BRSVL/10-251:0.26781,(O09634_HRSV/10-269:0.36362,O36633_HRSV/10-270:0.23261):1.16525);
ATP  (VGLG_ORSVW/10-251,VGLG_BRSVL/10-251,(O09634_HRSV/10-269,O36633_HRSV/10-270));
ATL  2.3561
DNO  4
DLN  783
DID  0.556179
DPH  (VGLG_ORSVW/10-251:6.32394,VGLG_BRSVL/10-251:4.76965,(O09634_HRSV/10-269:9.86956,O36633_HRSV/10-270:11.89799):45.06173);
DTP  (VGLG_ORSVW/10-251,VGLG_BRSVL/10-251,(O09634_HRSV/10-269,O36633_HRSV/10-270));
DTL  77.9466
RID  0.415506
RPH  (VGLG_ORSVW/10-251:0.32681,VGLG_BRSVL/10-251:0.26781,(O09634_HRSV/10-269:0.36362,O36633_HRSV/10-270:0.23261):1.16525);
RTP  (VGLG_ORSVW/10-251,VGLG_BRSVL/10-251,(O09634_HRSV/10-269,O36633_HRSV/10-270));
RTL  2.3561
LNK  O09634_HRSV/10-269:O09634:U39662
LNK  O36633_HRSV/10-270:O36633:AF013254
LNK  VGLG_BRSVL/10-251:O09495:U33539
LNK  VGLG_ORSVW/10-251:Q86695:S67863
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VGLG_ORSVW/10-251
ASQ  FKTLKKAWKASKYFIVGLSCLYKLNLKSLVQMALSALAMITLVSLTITAIIYISTGNTKAKPMPTPTIQITQQFQNHTSLPPTEHNHNSTHSPTQGTTSPHTFAVDVTEGTRYYHLTLKTQGGKTKGPPTPHATRKPPISSQKSNPSEIQQDYSDFQILPYVPCNICEGDSACLSLCQDRSESILDKALTTTPKKTPKPMTT-----------------KKPTKTSTHHRTS--LRNKLYIKTNMTTPPHGLISTAKHNKN
DSQ  TTCAAGACTCTTAAGAAAGCTTGGAAGGCTTCAAAGTATTTCATAGTGGGATTGTCTTGTCTATATAAACTTAATCTTAAATCCCTTGTCCAAATGGCCTTATCAGCCCTAGCAATGATAACTTTAGTATCACTTACCATAACAGCCATCATTTATATTAGCACAGGAAACACAAAAGCCAAACCCATGCCTACACCAACAATTCAGATCACCCAACAGTTCCAAAACCACACCTCTCTGCCTCCCACAGAACACAACCATAACTCTACTCACTCTCCAACTCAAGGCACCACATCACCCCACACTTTCGCCGTAGATGTCACCGAAGGAACTCGATACTACCACTTGACCCTCAAAACTCAAGGCGGTAAAACCAAAGGCCCTCCTACTCCACATGCCACAAGGAAACCCCCCATCAGTTCACAGAAGAGCAATCCCTCCGAAATTCAACAAGATTACAGTGACTTTCAAATACTTCCCTATGTGCCCTGCAACATATGTGAAGGTGACTCTGCTTGTTTATCCCTCTGTCAAGATAGATCCGAGAGCATACTGGATAAAGCTCTAACAACCACCCCCAAAAAAACTCCAAAACCCATGACCACC---------------------------------------------------AAAAAGCCAACCAAGACATCAACCCACCACAGAACCAGT------CTGAGAAACAAACTATACATCAAAACAAACATGACAACTCCACCACATGGCCTCATCTCCACAGCAAAACACAACAAAAAT
TRN  10010101100011000
NAM  VGLG_BRSVL/10-251
ASQ  LKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITAIIYISVGNAKAKPTSKPTIQQTQRPQNHTSPLFTEHNYKSTHTSIQSTTLSQLLNIDTTRGTTYSHPTDETQNRKIKSQSTLPATRQPPINPSGSNPPENHQDHNNSQTLPYVPCSTCEGNLACSSLCQIGLERAPSRAPTITLKKAPKPKTT-----------------KKPTKTTIHHRTS--PEAKLQPKNNTAAPQQGILSSPEHHTN
DSQ  CTCAAGACATTAAAGAGGGCTTGGAAAGCCTCAAAATACTTCATAGTAGGATTATCATGTTTATATAAGTTCAATTTAAAATCCCTTGTCCAAACGGCTTTGACCACCTTAGCAATGATAACCTTGACATCACTCGTCATAACAGCCATTATTTACATTAGTGTGGGAAATGCTAAAGCCAAGCCCACATCCAAACCAACCATCCAACAAACACAACGGCCCCAAAACCATACCTCACCTCTTTTCACAGAGCACAACTACAAATCAACTCACACATCAATCCAAAGCACCACACTGTCCCAACTACTAAACATAGACACCACTAGAGGAACTACATACAGTCACCCAACCGATGAAACCCAAAACAGAAAAATCAAAAGCCAATCCACTCTACCCGCCACCAGACAACCACCAATCAACCCATCGGGAAGTAACCCCCCTGAAAACCACCAAGACCACAACAACTCCCAAACACTCCCCTATGTGCCTTGCAGTACATGTGAAGGTAATCTTGCTTGCTCATCACTCTGCCAAATCGGGCTGGAGAGAGCACCAAGCAGAGCCCCCACAATCACCCTCAAAAAGGCTCCAAAACCCAAAACCACC---------------------------------------------------AAAAAACCAACCAAGACAACAATCCACCACAGAACCAGC------CCTGAAGCCAAACTGCAACCCAAAAACAACACGGCAGCTCCACAACAAGGCATCCTCTCTTCACCAGAACACCACACAAAT
TRN  10010101100011000
NAM  O36633_HRSV/10-270
ASQ  ARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAMIISTSLIIAAIIFIISANHKVTLTTVTVQTIKNHTEKNITTYLTQVPPERVSSSKQPTTTSPIHTNSATTSPNTKSETHHTTAQTKGRTTTSTQTNKPSTKPRLKNPPKKPKDDYHFEVFNFVPCSICGNNQLCKSICKTIPSNKPKKKPTIKPTNKPTTKTTNKRDPKTPAKTTKKETTTNPTKKPTLTTTERDTSTSQSTVLDTTTLEHTIQQQSLHSTT
DSQ  GCCAGGACTCTAGAAAAGACCTGGGATACTCTCAATCATCTAATTGTAATATCCTCTTGTTTATACAGATTAAATTTAAAATCTATAGCACAAATAGCACTATCAGTTCTGGCAATGATAATCTCAACCTCTCTCATAATTGCAGCCATAATATTCATCATCTCTGCCAATCACAAAGTTACACTAACAACGGTCACAGTTCAAACAATAAAAAACCACACTGAAAAAAACATCACCACCTACCTTACTCAAGTCCCACCAGAAAGGGTTAGCTCATCCAAACAACCTACAACCACATCACCAATCCACACAAATTCAGCCACAACATCACCCAACACAAAGTCAGAAACACACCACACAACAGCACAAACCAAAGGCAGAACCACCACCTCAACACAGACCAACAAGCCGAGCACAAAACCACGCCTAAAAAATCCACCAAAAAAACCAAAAGATGATTACCATTTTGAAGTGTTCAACTTCGTTCCCTGTAGTATATGTGGCAACAATCAACTTTGCAAATCCATCTGTAAAACAATACCAAGCAACAAACCAAAGAAGAAACCAACCATCAAACCCACAAACAAACCAACCACCAAAACCACAAACAAAAGAGACCCAAAAACACCAGCCAAAACGACGAAAAAAGAAACTACCACCAACCCAACAAAAAAACCAACCCTCACGACCACAGAAAGAGACACCAGCACCTCACAATCCACTGTGCTCGACACAACCACATTAGAACACACAATCCAACAGCAATCCCTCCACTCAACCACC
TRN  10010101100011000
NAM  O09634_HRSV/10-269
ASQ  AKTLEKTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAIIFIASANHKVTLTTAIIQDATSQIKNTTPTYLTQNPQLGISFSNLSETTSQTTTILASTTPSVKSTLQSTTVKTKNTTTTKIQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTIKTT-KKDLKPQTTKPKEVPTTKPTEKPTINTTKTNIRTTLLTNNTTGNPEHTSQKGTLHSTS
DSQ  GCCAAGACACTAGAAAAGACCTGGGACACTCTCAATCATCTATTATTCATATCATCGTGCTTATACAAGTTAAATCTTAAATCTATAGCACAAATCACATTATCCATTCTGGCAATGATAATCTCAACTTCACTTATAATTGCAGCCATCATATTCATAGCCTCGGCAAACCACAAAGTCACACTAACAACTGCAATCATACAAGATGCAACAAGCCAGATCAAGAACACAACCCCAACATACCTCACCCAGAATCCCCAGCTTGGAATCAGCTTCTCCAATCTGTCTGAAACTACATCACAAACCACCACCATACTAGCTTCAACAACACCAAGTGTCAAGTCAACCCTGCAATCCACAACAGTCAAGACCAAAAACACAACAACAACCAAAATACAACCCAGCAAGCCCACCACAAAACAACGCCAAAACAAACCACCAAACAAACCCAATAATGATTTTCACTTTGAAGTGTTCAACTTTGTACCTTGCAGCATATGCAGCAACAATCCAACCTGCTGGGCTATCTGTAAAAGAATACCAAACAAAAAACCTGGAAAGAAAACCACCACCAAGCCCACAAAAAAACCAACCATCAAGACAACC---AAAAAAGATCTCAAACCTCAAACCACAAAACCAAAGGAAGTACCTACCACCAAGCCCACAGAAAAGCCAACCATCAACACCACCAAAACAAACATCAGAACTACACTGCTCACCAACAATACCACAGGAAATCCAGAACACACAAGTCAAAAGGGAACCCTCCACTCAACCTCC
TRN  10010101100011000
//