EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00799 - Gemini_AL1)
FAM  PF00799
PID  Gemini_AL1
DES  Geminivirus AL1 protein
IPR  IPR001191
ANO  13
ALN  294
AID  0.423207
APH  ((VAL1_TYDVA/11-257:0.47853,((VAL1_PASVK/17-277:0.34133,VAL1_MSVK/10-272:0.28590):0.31996,VAL1_CSMV/34-285:0.56340):0.16165):0.05952,((((VAL1_PYMVV/7-293:0.14451,(VAL1_BGMV/7-293:0.16700,VAL1_ABMVW/7-292:0.17284):0.03803):0.02208,(VAL1_PHUV/7-290:0.16220,(VAL1_TYLCA/7-290:0.09245,VAL1_CLVK/6-289:0.15814):0.07809):0.09639):0.04162,VAL1_BCTV/7-293:0.19025):0.09902,VAL1_SLCV/8-289:0.30496):1.23004,VAL1_WDV/9-264:0.46039);
ATP  ((VAL1_TYDVA/11-257,((VAL1_PASVK/17-277,VAL1_MSVK/10-272),VAL1_CSMV/34-285)),((((VAL1_PYMVV/7-293,(VAL1_BGMV/7-293,VAL1_ABMVW/7-292)),(VAL1_PHUV/7-290,(VAL1_TYLCA/7-290,VAL1_CLVK/6-289))),VAL1_BCTV/7-293),VAL1_SLCV/8-289),VAL1_WDV/9-264);
ATL  5.6683
DNO  7
DLN  882
DID  0.464485
DPH  ((VAL1_TYDVA/11-257:0.32212,((VAL1_PHUV/7-290:0.22088,VAL1_BGMV/7-293:0.17544):0.12680,VAL1_BCTV/7-293:0.06652):0.79214):0.11598,(VAL1_PASVK/17-277:0.21957,VAL1_MSVK/10-272:0.27761):0.24934,VAL1_WDV/9-264:0.34278);
DTP  ((VAL1_TYDVA/11-257,((VAL1_PHUV/7-290,VAL1_BGMV/7-293),VAL1_BCTV/7-293)),(VAL1_PASVK/17-277,VAL1_MSVK/10-272),VAL1_WDV/9-264);
DTL  2.90918
RID  0.370527
RPH  (VAL1_WDV/9-264:0.42286,((VAL1_MSVK/10-272:0.28189,VAL1_PASVK/17-277:0.34490):0.40594,VAL1_TYDVA/11-257:0.49149):0.11407,(VAL1_BCTV/7-293:0.05264,(VAL1_BGMV/7-293:0.19678,VAL1_PHUV/7-290:0.22421):0.15091):1.36855);
RTP  (VAL1_WDV/9-264,((VAL1_MSVK/10-272,VAL1_PASVK/17-277),VAL1_TYDVA/11-257),(VAL1_BCTV/7-293,(VAL1_BGMV/7-293,VAL1_PHUV/7-290)));
RTL  4.05424
LNK  VAL1_ABMVW/7-292:P21947:
LNK  VAL1_BCTV/7-293:P14991:AF379637
LNK  VAL1_BGMV/7-293:P05175:M10070
LNK  VAL1_CLVK/6-289:P14982:
LNK  VAL1_CSMV/34-285:P18921:
LNK  VAL1_MSVK/10-272:P03568:X01089
LNK  VAL1_PASVK/17-277:Q00338:X60168
LNK  VAL1_PHUV/7-290:Q06923:X70418
LNK  VAL1_PYMVV/7-293:P27258:
LNK  VAL1_SLCV/8-289:P29048:
LNK  VAL1_TYDVA/11-257:P31617:M81103
LNK  VAL1_TYLCA/7-290:P36279:
LNK  VAL1_WDV/9-264:P06847:X02869
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VAL1_WDV/9-264
ASQ  FRVYSKYLFLTYPECTLEPQYALDSLRTLLNKYEPL.YIAAVRELHEDGSPHLHVLVQNKLRASITNPNALNLRMDTSpFSIFHPNIQAAKDCNQVRDYITKEVDsDVNTAEWGTFVAVS--------TPGR------K-DRDADMKQIIESSSSR---EE---FLSMVCNRFPFEWSIRLKDFEYTARHLFPDPVATYTPEF---PTES---LICHETIE--SWKNEHLYSVSLES--YILCTSTPADQAQS---DLEWMDDYSRSHR--.GGISPSTSAGQPEQERLPGQGL
DSQ  TTCCGTGTCTATTCCAAGTACCTCTTTCTAACATATCCTGAATGTACCCTTGAGCCACAGTACGCCTTGGATTCACTTCGCACTCTCTTGAACAAATATGAGCCCCTC...TACATCGCTGCTGTTAGAGAGCTCCACGAAGATGGATCACCACATCTGCACGTTCTCGTGCAGAACAAGCTTCGTGCTTCCATCACCAATCCCAATGCCTTAAACCTCCGTATGGATACATCTccaTTCTCCATATTCCATCCAAATATACAAGCTGCCAAAGACTGCAACCAAGTTCGTGATTACATCACGAAGGAGGTTGACtccGATGTAAACACAGCTGAGTGGGGAACATTCGTGGCTGTTTCA------------------------ACTCCAGGTCGT------------------AAA---GACCGTGATGCGGATATGAAACAGATCATTGAATCTAGTTCCTCTCGC---------GAGGAA---------TTCCTCAGCATGGTTTGCAATCGTTTTCCGTTTGAATGGTCTATCCGTCTCAAAGACTTCGAGTACACGGCACGCCATCTATTTCCTGACCCAGTTGCCACTTACACACCTGAGTTT---------CCAACCGAATCA---------CTCATTTGCCATGAGACCATTGAA------AGCTGGAAAAATGAACATCTCTACTCCGTAAGCCTCGAATCC------TATATCCTTTGTACTTCCACTCCTGCGGATCAAGCGCAATCT---------GACTTAGAGTGGATGGACGATTATTCCAGGAGTCACCGG------...GGAGGCATAAGTCCATCTACATCTGCGGGCCAACCAGAACAGGAAAGACTTCCTGGGCAAGGTCTC
TRN  10010101100011000
NAM  VAL1_TYDVA/11-257
ASQ  FRLQTKYVFLTYPRCSSSAENLRDFLWDKLSRFAIF.FIAIATELHQDGTPHLHCLIQLDKRSNIRDPSFFDLEG---.---NHPNIQPAKNSEQVLEYISKDG-.--NVITKGEFKKHR-------VSPSK---------SDERWRTIIQTATSK---EE---YLDMIKDEFPHEWATKLQWLEYSANKLFPPQPEIYQATF----TEED--LQCHEDLQ--LWRDQHLYHVSVDAYR--LVHNVTLVEAHS---DLVWMDDISRNLEGLePGSPPSTSADQVVPERQHGPEA
DSQ  TTCAGACTCCAAACCAAATATGTCTTCCTTACTTATCCACGCTGCAGCTCTAGTGCAGAAAATCTCAGAGATTTCCTCTGGGATAAACTTTCACGTTTTGCTATTTTC...TTTATCGCTATTGCTACTGAACTCCACCAGGATGGTACTCCCCATCTTCACTGCCTTATACAGCTTGACAAAAGAAGCAATATACGTGACCCTTCTTTTTTTGATCTTGAAGGA---------...---------AACCATCCAAATATCCAACCAGCTAAAAACTCTGAACAAGTTCTTGAATACATCTCCAAAGACGGA---...------AACGTCATCACCAAAGGAGAGTTCAAGAAACACAGA---------------------GTCTCCCCTTCCAAA---------------------------TCTGATGAGCGATGGCGAACTATTATCCAGACTGCGACTTCTAAA---------GAGGAA---------TATCTGGACATGATAAAGGATGAATTTCCTCATGAATGGGCAACAAAATTACAGTGGTTGGAATACTCTGCAAATAAACTATTTCCACCACAACCTGAAATCTACCAGGCCACATTC------------ACTGAGGAAGAT------CTCCAATGTCATGAAGATCTGCAG------TTATGGAGAGACCAGCATCTATACCACGTAAGTGTAGATGCTTACCGT------CTAGTTCATAACGTCACACTTGTTGAAGCACACTCT---------GACTTAGTTTGGATGGACGACATATCCAGGAACCTAGAAGGGCTGgaaCCAGGATCCCCTCCCTCTACATCTGCGGACCAAGTCGTACCGGAAAGACAACATGGGCCAGAAGCC
TRN  10010101100011000
NAM  VAL1_PASVK/17-277
ASQ  FRHRNANTFLTYSKCPLEPEFIGEHLFRLTREYEPA.YILVVRETHTDGTWHCHALLQCIKPCTTRDERYFDIDR---.---YHGNIQSAKSTDKVREYILKDPK.--DKWEKGTYIPRK----KSFVPPGK-EPAEKKPTKDEVMREIMTHATSR---EE---YLSLVQSSLPYDWATKLNYFEYSASRLFPDIAEPYTNPH--PTTEYD--LHCNETIE--DWLKPNIYQVSPQAYKLLEPSCLSLEQAIA---DLEWLDDTT-RMLQE.KEREASTSAAQHGQVKHPGLEA
DSQ  TTCAGGCACCGGAACGCGAACACCTTCCTCACATACAGCAAGTGTCCACTAGAACCAGAGTTCATCGGTGAGCATCTCTTCAGACTCACTAGGGAATATGAGCCAGCA...TACATCTTAGTAGTCAGGGAGACACACACAGACGGGACATGGCACTGCCATGCACTCCTGCAATGCATCAAGCCTTGCACTACTCGTGACGAGAGGTACTTTGACATAGATCGG---------...---------TACCATGGGAACATACAGAGCGCCAAGAGCACTGACAAGGTGCGTGAGTACATACTGAAGGACCCCAAG...------GACAAGTGGGAGAAAGGTACATACATCCCAAGGAAG------------AAGAGCTTCGTCCCTCCAGGTAAG---GAGCCAGCTGAGAAGAAACCTACCAAGGATGAAGTCATGAGAGAGATCATGACACATGCTACTAGTAGG---------GAAGAG---------TACCTTTCTCTAGTGCAGAGCAGCCTCCCGTATGACTGGGCTACAAAACTGAACTACTTTGAATACTCAGCTAGTCGCCTCTTCCCGGACATTGCAGAGCCTTACACCAATCCTCAT------CCTACCACTGAATATGAC------CTCCACTGCAATGAGACAATTGAG------GACTGGCTAAAGCCAAACATATATCAGGTCAGTCCTCAAGCTTACAAACTCCTAGAACCTAGCTGCTTAAGCCTAGAACAGGCAATTGCT---------GACTTAGAATGGTTGGATGATACAACC---AGAATGCTCCAGGAG...AAAGAAAGAGAAGCCTCTACATCTGCGGCCCAACACGGACAGGTAAAACATCCTGGGCTAGAAGCC
TRN  10010101100011000
NAM  VAL1_MSVK/10-272
ASQ  FSHRNANTFLTYPKCPENPEIACQMIWELVVRWIPK.YILCAREAHKDGSLHLHALLQTEKPVRISDSRFFDING---.---FHPNIQSAKSVNRVRDYILKEPL.--AVFERGTFIPRK----SPFLGKSDSEVKEKKPSKDEIMRDIISHSTSK---EE---YLSMIQKELPFDWSTKLQYFEYSANKLFPEIQEEFTNPH--PPSSPD--LLCNESIN--DWLQPNIFQVSPEAYMLLQPACYTLDDAIS---DLQWMDSVSSHQMKD.QESRASTSSAQQEQENLLGPEA
DSQ  TTCTCACACAGGAACGCTAACACGTTCCTAACCTACCCAAAGTGTCCAGAAAATCCTGAAATCGCCTGTCAGATGATCTGGGAGCTCGTTGTTCGTTGGATTCCCAAA...TATATTCTATGTGCCCGAGAGGCACATAAAGATGGAAGTTTGCATTTACATGCATTGCTTCAGACAGAGAAGCCGGTAAGGATATCTGACTCAAGGTTCTTTGATATAAATGGG---------...---------TTTCACCCAAATATTCAGAGTGCCAAGTCAGTTAACAGGGTGAGGGATTACATTCTCAAGGAACCTCTG...------GCTGTGTTTGAGAGAGGTACTTTCATTCCTAGGAAG------------TCCCCCTTCCTAGGAAAATCTGATTCAGAAGTAAAGGAAAAAAAGCCTTCCAAAGATGAAATAATGCGAGACATTATTTCACACTCTACTTCCAAG---------GAAGAG---------TACCTCTCCATGATCCAGAAAGAGCTTCCCTTTGATTGGTCCACAAAATTGCAGTATTTTGAATACTCTGCAAATAAGCTTTTCCCTGAGATTCAGGAAGAGTTCACCAATCCTCAT------CCACCCTCCTCACCTGAT------TTACTTTGTAATGAGTCAATCAAT------GATTGGCTCCAGCCTAACATCTTCCAGGTTAGTCCCGAAGCTTACATGCTCCTTCAACCTGCCTGTTATACCCTCGATGATGCAATTTCT---------GACCTCCAATGGATGGATTCTGTATCCAGTCATCAGATGAAAGAT...CAAGAAAGCAGAGCCTCTACATCGTCGGCCCAACAAGAACAGGAAAATCTACTTGGGCCAGAAGCC
TRN  10010101100011000
NAM  VAL1_CSMV/34-285
ASQ  FSLRTKHVFLTYPRCPISPEEAGQKIADRLKNKKCN.YIYISREFHADGEPHLHAFVQLEANFRTTSPKYFDLDE---.---FHPNIQAARQPASTLKYCMKHPE.--SSWEFGKFLKPK---------VNR--SPTQSASRDKTMKQIMANATSRD---E---YLSMVRKSFPFEWAVRLQQFQYSANALFPDPPQTYSAPY----ASRD--MSDHPVIG--EWLQQELYTVSPQA---LSLHAGISEEQAR--IDLQWMSDLTRSGALE.SGDEACTSVGQQELERLLGPEV
NAM  VAL1_TYLCA/7-290
ASQ  FRINAKNYFLTYPKCSLTKEEALSQLNNLETPTSKK.YIKVCRELHENGEPHLHVLIQFEGKFQCKNQRFFDLVSPTR.SAHFHPNIQGAKSSSDVKSYLEKDG-.--DTLEWGEFQIDGRSARGGQQSANDAYAQALNTGSKSEALNVLRELAPKDYVLQFHNLNSNLDRIFTPPLEVYVSPFLSSSFDRVPEELEEWVAEN-VKDAAARPLRPISIVIEGESRTGKTVWARSLGPHNYLCGHLDLSPKVYSNDAWYNVIDDVDPHYL--.KHFKEFMGAQRDWQSNTKYGKP
NAM  VAL1_CLVK/6-289
ASQ  FRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPK.FIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSC.STSFHPNIQGAKSSSDVKSYLDKDG-.--DTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADN-VRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYL--.KHFKEFMGSQRDWQSNTKYGKP
NAM  VAL1_PHUV/7-290
ASQ  FRLNAKNYFLTYPQCSISKEERLAQLQNLSTPVNKK.YIKICKESHEDGQPHLHVLIQFEGKYQCTNNRFFDLVSSTR.SAHFHPNIQGAKSSSDVKTYIDKDG-.--DTVEWGEFQIDGRSARGGQQSANDTYAKALNSASAEEALQIIKEEQPQHFFLQFHNIVSNANRIFQTPPEPWVPPFQQASFNNVPAIMTQWVSDN-VCDAAARPMRPLSLVVEGPSRTGKTLWARSLGPHNYICGHMDLSPKIYSNNAWYNVIDDIPPHYV--.KHFKEFMGAQRDWQSNCKYGKP
DSQ  TTTCGTTTAAATGCCAAGAATTATTTCCTCACCTATCCACAATGTTCCATTTCCAAAGAAGAGCGTCTCGCTCAACTACAAAACCTCTCGACGCCGGTAAACAAGAAG...TACATCAAAATTTGCAAAGAATCTCATGAAGATGGGCAACCTCATCTGCACGTGCTTATTCAGTTCGAAGGAAAATACCAATGCACGAACAACCGATTCTTTGACCTCGTATCCTCTACCAGA...TCAGCACATTTCCATCCGAACATTCAGGGAGCTAAATCAAGCTCCGACGTCAAGACGTACATCGACAAAGACGGC---...------GATACCGTAGAATGGGGAGAATTCCAAATAGACGGCAGATCTGCTAGAGGAGGACAGCAGTCTGCTAATGACACATATGCTAAGGCGTTAAATTCAGCATCTGCAGAAGAAGCTCTGCAGATCATAAAGGAAGAACAACCTCAGCATTTCTTCCTCCAATTTCATAACATTGTGTCAAACGCTAATCGGATATTCCAAACTCCCCCGGAACCGTGGGTTCCTCCATTTCAACAGGCGTCCTTTAATAATGTGCCTGCAATAATGACACAATGGGTGTCTGATAAT---GTATGTGATGCCGCTGCGCGGCCAATGAGACCATTGTCATTAGTGGTCGAGGGTCCTTCACGGACAGGCAAAACATTATGGGCCCGAAGTCTCGGCCCACACAATTACATATGTGGTCATATGGATCTCAGCCCAAAAATCTACTCCAATAATGCATGGTATAACGTCATTGATGACATCCCTCCGCATTATGTT------...AAGCACTTTAAAGAGTTTATGGGGGCCCAACGGGATTGGCAATCAAACTGCAAATACGGCAAACCA
TRN  10010101100011000
NAM  VAL1_PYMVV/7-293
ASQ  FSIKAKNYFLTYPQCSISKEEALSQLQNLTIPVNKK.FIKICRELHENGEPHLHVLIQFEGKYNCTNNRLFDLVSPTR.STHFHPNIQGAKSSSDVKSYVEKDG-.--DTIEWGLFQIDGRSARGGQQTVNDAAAEALNSGTKEAAMKIIKEKLPEKFLFQYHNLSCNLDRIFMKAPETWAPPFPLSSFTNVPDEMQEWADGYFGKSSAARPERPISIIIEGDSRRGKTMWARVLGPHNYLSGHLDFNPRVYSNEVEYNVIDDVAPQYLKL.KHWKELLGAQRDWQSNCKYGKP
NAM  VAL1_BGMV/7-293
ASQ  FRVQSKNYFLTYPRCTIPKEEALSQLQKIHTTTNKK.FIKVCEERHDNGEPHLHALIQFEGKFICTNKRLFDLVSTTR.SAHFHPNIQGAKSSSDVKEYIDKDG-.--VTIEWGQFQVDGRSARGGQQSANDSYAKALNADSIESALTILKEEQPKDYVLQNHNIRSNLERIFFKVPEPWVPPFPLSSFVNIPVVMQDWVDDYFGRGSAARPERPISIIVEGDSRTGKTMWARALGPHNYLSGHLDFNSLVYSNSVEYNVIDDITPNYLKL.KDWKELIGEQKDWQSNCKYGKP
DSQ  TTTAGAGTTCAGTCCAAAAACTATTTCCTCACTTATCCTCGTTGCACTATACCGAAAGAAGAAGCTCTTTCGCAACTTCAAAAGATTCATACAACGACGAATAAGAAA...TTCATCAAGGTCTGTGAGGAACGTCACGATAATGGTGAACCCCATCTTCATGCGCTTATTCAGTTCGAAGGTAAATTCATCTGCACAAATAAAAGATTGTTCGACCTGGTATCCACAACCAGG...TCAGCACATTTCCATCCGAACATTCAGGGAGCTAAATCAAGTTCCGACGTCAAAGAATACATCGACAAAGATGGA---...------GTCACAATCGAATGGGGACAATTCCAAGTCGACGGCAGATCTGCAAGAGGAGGTCAGCAGTCTGCCAACGACTCATACGCAAAGGCATTAAACGCAGATTCAATTGAATCTGCCTTGACAATATTGAAGGAAGAACAACCGAAAGATTACGTCCTTCAAAATCACAACATCCGTTCTAATCTCGAACGGATCTTCTTCAAAGTGCCGGAACCATGGGTTCCTCCATTTCCGTTGTCATCATTCGTCAATATTCCGGTTGTTATGCAAGACTGGGTTGACGACTATTTCGGAAGGGGTTCCGCTGCGCGGCCAGAAAGACCTATTAGTATCATCGTCGAAGGTGATTCACGAACTGGAAAGACAATGTGGGCTCGTGCATTAGGCCCACATAATTATTTGAGCGGTCATTTGGACTTTAATTCACTTGTCTATTCGAACTCAGTGGAATACAACGTCATTGATGACATAACCCCGAATTATTTGAAGTTA...AAGGACTGGAAAGAGCTAATTGGGGAACAAAAGGACTGGCAATCCAACTGTAAATATGGAAAGCCG
TRN  10010101100011000
NAM  VAL1_ABMVW/7-292
ASQ  FRVQAKNYFLTYPQCSLTKDEALSQLQNLETPVNKK.FIKICRELHENGEPHLHVLIQFEGKYQCTNNRFFDLVSPTR.SAHFHPNIQGAKSSSDVKSYIDKDG-.--DTAEWGEFQIDGRSARGGQQTANDSYAKALNAGDVQSALNILKEEQPKDYVLQNHNIRSNLERIFAKAPEPWVAGFPSPLSRPFPRRCRSGRMIILGVVPLRP-DRPLSLIVEGDSRTGKTMWARALGPHNYLSGHLDFNGRVYSNEVEYNVIDDVAPHYLKL.KHWKELLGAQKDWQSNCKLAKP
NAM  VAL1_BCTV/7-293
ASQ  FRIQAKNIFLTYPQCSLSKEEALEQIQGIQLSSNKK.YIKIARELHEDGQPHLHVLLQLEGKVQITNIRLFDLVSPTR.SAHFHPNIQGAKSSSDVKSYVDKDG-.--DTIEWGEFQIDGRSARGGQQTANDSYAKALNATSLEQALQILKEEQPKDYFLQHHNLLNNAQKIFQRAPDPWTPLFPLSSFTNVPEEMQEWADAYFGVDAAARPLRYNSIIVEGDSRTGKTMWARSLGAHNYITGHLDFSLRTYYDEVEYNVIDDVDPTYLKM.KHWKHLIGAQKEWQTNLKYGKP
DSQ  TTTCGTATTCAAGCAAAAAACATATTTCTTACATATCCTCAGTGTTCTCTTTCAAAAGAAGAAGCTCTTGAGCAAATTCAAGGAATACAACTTTCATCTAATAAAAAA...TATATTAAAATTGCCAGAGAGCTACACGAAGATGGGCAACCTCATCTCCACGTCCTGCTTCAACTCGAAGGAAAAGTTCAGATCACAAATATCAGATTATTCGACCTGGTATCCCCAACCAGG...TCAGCACATTTCCATCCGAACATTCAGGGAGCTAAATCCAGCTCCGACGTCAAGTCCTACGTCGACAAGGACGGA---...------GACACAATTGAATGGGGGGAATTCCAGATCGACGGTAGAAGTGCTAGAGGAGGTCAACAGACAGCTAACGACTCATATGCCAAGGCGTTAAACGCAACTTCTCTTGAACAAGCACTTCAAATATTGAAGGAAGAACAACCAAAGGATTACTTCCTTCAACATCACAATCTTTTGAACAATGCTCAAAAGATATTTCAGAGGGCACCTGATCCATGGACTCCACTATTTCCTCTGTCCTCATTCACAAACGTTCCTGAGGAAATGCAAGAATGGGCTGATGCATATTTTGGGGTTGATGCCGCTGCGCGGCCTTTAAGATATAATAGTATCATAGTAGAGGGTGATTCAAGAACAGGGAAGACTATGTGGGCTAGATCTTTAGGGGCCCACAATTACATCACAGGGCATTTAGATTTTAGCCTTAGAACATATTATGATGAAGTGGAATACAACGTCATTGATGACGTAGATCCCACTTACTTAAAGATG...AAACACTGGAAGCACCTTATTGGAGCACAAAAGGAGTGGCAGACAAACTTAAAGTATGGAAAACCA
TRN  10010101100011000
NAM  VAL1_SLCV/8-289
ASQ  FRLTARNIFLTYPRCDVPKEEVLEMLLHLSWSVVKPnYVRVAREEHSDGSPHLHCLIQLSGKSNIKDAGFFDLTHPRR.SARFHPNIQAAKDTNAVKNYITKEG-.--DYCESGQYKVSG----GSKSNKDDVYHNAVNAGSAGEALDIIKAGDPKTFIVNYHNLLANVERLFQKPPEPWVPPFELSSFTSVPEELQDWADDYFNECSAAA--RPTSIIIEGGSRTGKTMWARSLGPHNYLSGHLDFNSRVFSNDVKYNVIDDVAPHYLKL.KHWKELIGAQRDWQSNCKYGKP
//