EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00770 - Peptidase_C5)
FAM  PF00770
PID  Peptidase_C5
DES  Adenovirus endoprotease
IPR  IPR000855
ANO  13
ALN  183
AID  0.564576
APH  (((((((ADEN_ADECT/23-205:0.20757,(ADEN_ADE02/20-202:0.12129,((ADEN_ADE12/20-202:0.15792,ADEN_ADE03/26-207:0.09821):0.04879,ADEN_ADE40/20-202:0.13237):0.06348):0.06928):0.05238,ADEN_ADEB2/20-200:0.24873):0.04859,ADEN_ADEB3/20-202:0.19194):0.11856,ADEN_ADEE2/20-201:0.33202):0.03951,(ADEN_ADEP3/19-201:0.36733,ADEN_ADEM1/19-201:0.27213):0.04608):0.68250,P87664_9ADEN/21-199:0.31206):0.13407,ADEN_ADEO7/21-199:0.25869,ADEN_ADEB7/21-199:0.18286);
ATP  (((((((ADEN_ADECT/23-205,(ADEN_ADE02/20-202,((ADEN_ADE12/20-202,ADEN_ADE03/26-207),ADEN_ADE40/20-202))),ADEN_ADEB2/20-200),ADEN_ADEB3/20-202),ADEN_ADEE2/20-201),(ADEN_ADEP3/19-201,ADEN_ADEM1/19-201)),P87664_9ADEN/21-199),ADEN_ADEO7/21-199,ADEN_ADEB7/21-199);
ATL  4.18008
DNO  13
DLN  549
DID  0.557217
DPH  (((((ADEN_ADEB3/20-202:0.22824,(((ADEN_ADE03/26-207:0.15471,(ADEN_ADE40/20-202:0.14700,ADEN_ADE12/20-202:0.24105):0.08538):0.04054,ADEN_ADE02/20-202:0.12489):0.08831,ADEN_ADEP3/19-201:0.32881):0.06837):0.06009,ADEN_ADECT/23-205:0.17319):0.11309,ADEN_ADEB2/20-200:0.22311):0.08840,ADEN_ADEE2/20-201:0.26842):0.10329,((ADEN_ADEB7/21-199:0.18294,ADEN_ADEO7/21-199:0.24970):0.09073,P87664_9ADEN/21-199:0.25901):0.42660,ADEN_ADEM1/19-201:0.26068);
DTP  (((((ADEN_ADEB3/20-202,(((ADEN_ADE03/26-207,(ADEN_ADE40/20-202,ADEN_ADE12/20-202)),ADEN_ADE02/20-202),ADEN_ADEP3/19-201)),ADEN_ADECT/23-205),ADEN_ADEB2/20-200),ADEN_ADEE2/20-201),((ADEN_ADEB7/21-199,ADEN_ADEO7/21-199),P87664_9ADEN/21-199),ADEN_ADEM1/19-201);
DTL  4.00655
RID  0.564576
RPH  (((((((ADEN_ADECT/23-205:0.20757,(ADEN_ADE02/20-202:0.12129,((ADEN_ADE12/20-202:0.15792,ADEN_ADE03/26-207:0.09821):0.04879,ADEN_ADE40/20-202:0.13237):0.06348):0.06928):0.05238,ADEN_ADEB2/20-200:0.24873):0.04859,ADEN_ADEB3/20-202:0.19194):0.11856,ADEN_ADEE2/20-201:0.33202):0.03951,(ADEN_ADEP3/19-201:0.36733,ADEN_ADEM1/19-201:0.27213):0.04608):0.68250,P87664_9ADEN/21-199:0.31206):0.13407,ADEN_ADEO7/21-199:0.25869,ADEN_ADEB7/21-199:0.18286);
RTP  (((((((ADEN_ADECT/23-205,(ADEN_ADE02/20-202,((ADEN_ADE12/20-202,ADEN_ADE03/26-207),ADEN_ADE40/20-202))),ADEN_ADEB2/20-200),ADEN_ADEB3/20-202),ADEN_ADEE2/20-201),(ADEN_ADEP3/19-201,ADEN_ADEM1/19-201)),P87664_9ADEN/21-199),ADEN_ADEO7/21-199,ADEN_ADEB7/21-199);
RTL  4.18008
LNK  ADEN_ADE02/20-202:P03252:J01917
LNK  ADEN_ADE03/26-207:P10381:X13271
LNK  ADEN_ADE12/20-202:P09569:X73487
LNK  ADEN_ADE40/20-202:P11825:M19540
LNK  ADEN_ADEB2/20-200:Q96629:U44124
LNK  ADEN_ADEB3/20-202:P19119:X53990
LNK  ADEN_ADEB7/21-199:P19151:X53989
LNK  ADEN_ADECT/23-205:P87563:U77082
LNK  ADEN_ADEE2/20-201:O40958:L80007
LNK  ADEN_ADEM1/19-201:P30202:M81056
LNK  ADEN_ADEO7/21-199:Q83906:U40839
LNK  ADEN_ADEP3/19-201:Q84177:U33016
LNK  P87664_9ADEN/21-199:P87664:U63515
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ADEN_ADEM1/19-201
ASQ  SFLGIFDKHFPGFISVNKPACAIVNTASRETGGVHWLAMAWYPTSSTFYLFDPFGFSDRKLQQVYKFEYERLLKRSAVSSSSSKCVTLVKSHQTVQGPHSAACGLFCVLFLAAFGKYPQNPMNNNPIMGPIEGVPNDQMFNPCYTKTLYRNQQWVYSYLNKNSLYFRLHVELIKKNTAFDKLL
DSQ  TCTTTTTTAGGTATTTTTGATAAACACTTCCCCGGCTTTATAAGTGTTAACAAACCGGCTTGTGCTATCGTTAATACAGCAAGTCGAGAAACTGGAGGGGTACACTGGCTAGCTATGGCTTGGTATCCTACCTCTTCCACTTTTTACTTGTTTGATCCGTTTGGATTTTCGGATCGTAAACTGCAACAAGTGTATAAGTTCGAGTACGAACGGCTTCTCAAACGATCAGCTGTTAGCAGCTCTAGCAGCAAGTGTGTAACACTAGTAAAAAGCCACCAAACCGTCCAGGGGCCTCATAGCGCAGCGTGTGGACTCTTTTGTGTTCTATTTTTAGCAGCTTTCGGAAAGTATCCACAAAACCCCATGAACAATAACCCAATCATGGGACCGATTGAGGGAGTTCCTAACGATCAAATGTTTAATCCCTGCTATACTAAAACCTTGTACCGTAATCAACAATGGGTATATTCTTACTTAAATAAGAACTCGCTTTATTTTAGGCTACATGTAGAACTTATTAAAAAAAATACAGCGTTTGACAAATTGTTA
TRN  10010101100011000
NAM  ADEN_ADEB3/20-202
ASQ  YFLGTFDKHFPGFISKDRMSCAIVNTAGRETGGVHWLAMAWHPASQTFYMFDPFGFSDQKLKQIYNFEYQGLLKRSALTSTADRCLTLIQSTQSVQGPNSAACGLFCCMFLHAFVRWPLRAMDNNPTMNLIHGVPNNMLESPSSQNVFLRNQQNLYRFLRRHSPHFVKHAAQIEADTAFDKML
DSQ  TACTTCCTCGGCACTTTCGATAAACACTTTCCGGGGTTCATCTCCAAAGACCGAATGAGCTGTGCCATAGTCAACACTGCCGGACGCGAAACCGGGGGCGTGCATTGGCTGGCCATGGCTTGGCACCCAGCCTCGCAGACCTTTTACATGTTTGACCCTTTCGGTTTCTCGGATCAAAAGCTAAAGCAAATTTACAACTTTGAGTATCAGGGCCTCCTAAAGCGCAGCGCCCTGACTTCCACTGCTGACCGCTGCCTGACCCTTATTCAAAGCACTCAATCTGTCCAGGGACCCAACAGCGCCGCCTGCGGTCTGTTCTGCTGCATGTTCCTCCACGCCTTTGTCCGCTGGCCGCTTAGGGCCATGGACAACAATCCCACCATGAACCTCATCCACGGAGTTCCCAACAACATGTTGGAGAGCCCCAGCTCCCAAAATGTGTTTTTGAGAAACCAGCAAAATCTGTACCGTTTCCTAAGACGCCACTCCCCCCATTTTGTTAAGCATGCGGCTCAAATTGAGGCTGACACCGCCTTTGATAAAATGTTA
TRN  10010101100011010
NAM  ADEN_ADE40/20-202
ASQ  YFLGTFDKRFPGFMAPHKLACAIVNTAGRETGGVHWLALAWNPKNRTCYLFDPFGFSDERLKQIYQFEYEGLLKRSALASTPDHCITLIKSTQTVQGPFSAACGLFCCMFLHAFVNWPTSPMERNPTMDLLTGVPNSMLQSPQVVPTLRHNQERLYRFLAQRSPYFQRHCERIKKATAFDQMK
DSQ  TACTTTCTGGGCACGTTTGACAAACGCTTTCCGGGTTTTATGGCACCGCATAAGCTGGCGTGTGCCATTGTTAACACGGCGGGCCGCGAAACCGGCGGCGTACACTGGCTGGCCCTGGCCTGGAACCCAAAGAACCGTACCTGCTACCTCTTCGACCCATTTGGCTTTTCGGACGAGCGCCTCAAACAGATTTACCAGTTTGAGTATGAAGGTCTCCTAAAGCGTAGTGCGTTGGCCTCAACCCCGGACCATTGTATCACCCTAATTAAGTCCACCCAAACTGTTCAAGGACCGTTTTCGGCGGCCTGCGGCCTTTTCTGCTGCATGTTTTTACATGCTTTTGTAAACTGGCCCACCAGTCCCATGGAGCGCAACCCCACCATGGACCTTCTTACCGGCGTTCCAAACAGCATGCTTCAAAGCCCCCAGGTTGTACCCACCCTGCGTCACAACCAGGAGCGGTTGTACCGTTTCCTGGCGCAACGTTCTCCCTACTTTCAGCGTCATTGCGAGCGTATCAAAAAAGCCACCGCGTTTGACCAAATGAAA
TRN  11011101101011000
NAM  ADEN_ADE03/26-207
ASQ  YFLGTFDKRFPGFMAPDKLACAIVNTAGRETGGEHWLAFGWNPRYNTCYLFDPFGFSDERLKQIYQFEYEGLLRRSALA-TKDRCITLEKSTQSVQGPRSAACGLFCCMFLHAFVHWPDRPMDGNPTMKLVTGVSNSMLQSPQVQPTLRRNQEVLYRFLNTHSSYFRSHRARIERATAFDRMD
DSQ  TATTTCCTGGGAACCTTTGACAAGCGTTTCCCGGGGTTCATGGCCCCCGACAAGCTCGCCTGCGCCATAGTCAACACTGCCGGACGCGAGACGGGGGGAGAGCACTGGCTGGCTTTTGGTTGGAACCCGCGCTACAACACCTGCTACCTTTTTGATCCTTTTGGGTTCTCGGATGAGCGGCTCAAACAGATTTACCAGTTTGAGTACGAGGGGCTCCTGCGTCGCAGTGCCCTTGCT---ACCAAAGACCGCTGCATCACCCTGGAGAAGTCTACCCAAAGCGTGCAGGGTCCGCGCTCAGCCGCCTGTGGACTTTTTTGCTGTATGTTCCTTCATGCCTTTGTGCACTGGCCCGACCGCCCCATGGACGGAAACCCCACCATGAAGTTGGTGACTGGGGTGTCCAACAGCATGCTCCAATCACCCCAAGTCCAGCCCACCCTGCGCCGCAACCAGGAGGTGCTATACCGCTTCCTAAACACCCACTCATCTTACTTTCGTTCTCACCGCGCGCGCATTGAAAGGGCCACCGCGTTTGACCGTATGGAT
TRN  10010101100011001
NAM  ADEN_ADE12/20-202
ASQ  YFLGTFDKRFPGFVSRDRLSCAIVNTAGRETGGVHWLAFGWNPKSHTCYLFDPFGFSDQRLKQIYQFEYESLLRRSALAATKDRCVTLEKSTQTVQGPFSAACGLFCCMFLHAFTHWPDHPMDKNPTMDLLTGVPNCMLQSPQVVGTLQRNQNELYKFLNNLSPYFRHNRERIEKATSFTKMQ
DSQ  TATTTTTTGGGAACCTTTGACAAACGTTTTCCGGGTTTTGTGTCTCGCGACCGCTTATCATGTGCTATTGTTAACACTGCCGGTCGCGAAACTGGGGGCGTACACTGGCTGGCTTTTGGATGGAACCCCAAATCGCACACTTGCTATTTATTCGATCCATTTGGATTTTCTGATCAACGACTAAAACAAATCTATCAGTTTGAGTACGAAAGTCTGTTGCGCCGTAGTGCGCTAGCGGCCACTAAAGACCGATGCGTTACCCTAGAAAAGTCAACCCAAACTGTACAAGGACCGTTTTCTGCAGCGTGCGGCCTGTTTTGTTGTATGTTCTTACACGCTTTTACTCACTGGCCTGACCATCCAATGGATAAAAATCCCACTATGGACCTACTTACTGGGGTGCCTAATTGTATGCTACAAAGTCCTCAGGTAGTGGGCACATTGCAACGCAATCAGAATGAATTGTATAAATTCTTAAACAATCTGTCCCCTTACTTTCGTCACAACCGCGAGCGCATAGAAAAAGCTACATCTTTTACTAAAATGCAA
TRN  10010101100011000
NAM  ADEN_ADE02/20-202
ASQ  YFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPRSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLK
DSQ  TATTTTTTGGGCACCTATGACAAGCGCTTTCCAGGCTTTGTTTCTCCACACAAGCTCGCCTGCGCCATAGTCAATACGGCCGGTCGCGAGACTGGGGGCGTACACTGGATGGCCTTTGCCTGGAACCCGCGCTCAAAAACATGCTACCTCTTTGAGCCCTTTGGCTTTTCTGACCAACGACTCAAGCAGGTTTACCAGTTTGAGTACGAGTCACTCCTGCGCCGTAGCGCCATTGCTTCTTCCCCCGACCGCTGTATAACGCTGGAAAAGTCCACCCAAAGCGTGCAGGGGCCCAACTCGGCCGCCTGTGGACTATTCTGCTGCATGTTTCTCCACGCCTTTGCCAACTGGCCCCAAACTCCCATGGATCACAACCCCACCATGAACCTTATTACCGGGGTACCCAACTCCATGCTTAACAGTCCCCAGGTACAGCCCACCCTGCGTCGCAACCAGGAACAGCTCTACAGCTTCCTGGAGCGCCACTCGCCCTACTTCCGCAGCCACAGTGCGCAGATTAGGAGCGCCACTTCTTTTTGTCACTTGAAA
TRN  10010101100011001
NAM  ADEN_ADEB2/20-200
ASQ  YFLGTFDKRFPGFLHKDKLSCAIVNTAARETGGAHWLALAWFPNAKNFYFFDPFGFSDHKLKQIYQFEYEGLLRRSALA--GDGCVNLVKSTETVQGPNSAACGLFCCMFLHAFVNWPDRPMTRNPTMDLLTGVPNADMMKPSSLAILRENQNQLYKFLSTHSQYFRTHRPQIERDTSFNKLL
DSQ  TACTTTTTAGGAACTTTTGACAAGCGCTTCCCAGGTTTCTTGCATAAAGATAAACTGAGTTGCGCGATTGTCAATACAGCGGCCCGCGAGACCGGTGGGGCACACTGGCTTGCCCTAGCTTGGTTTCCAAACGCTAAAAACTTTTATTTTTTCGACCCGTTTGGGTTTTCTGACCATAAACTTAAACAAATTTATCAGTTTGAATATGAAGGCTTGTTGCGCCGAAGCGCGCTAGCG------GGCGATGGCTGCGTAAATTTAGTAAAAAGCACCGAAACAGTTCAAGGACCAAACAGCGCCGCCTGTGGGTTATTTTGTTGCATGTTTTTACACGCTTTTGTAAATTGGCCAGACCGCCCAATGACACGAAACCCCACAATGGATTTGCTAACTGGCGTTCCTAATGCTGATATGATGAAACCGTCGTCGCTTGCAATTTTAAGAGAAAACCAAAATCAGCTGTATAAGTTTTTGTCAACCCACTCCCAATACTTTCGCACTCACCGCCCCCAAATTGAACGCGATACCTCTTTTAATAAACTGCTA
TRN  10010101100011000
NAM  ADEN_ADECT/23-205
ASQ  FFLGTFDKRFPGFISSQRMACAIVNTAGRETGGVHWLAMAWNPRSKTFYMFDPFGFSDSKLKQVYSFEYEGLLRRSAIASSPDRCVTLAKSNETIQGPNSAACGLFCCMFLHAFVNWPDDPFDHNPTMGPLKSVPNYKLNDPTVQYVLWGNQEKLYKFLEKHSAYFRAHAAAIKARTAFNKLK
DSQ  TTTTTCTTGGGCACCTTTGACAAGAGGTTTCCGGGTTTCATCTCTTCACAAAGAATGGCCTGCGCCATAGTAAACACCGCAGGCCGAGAAACGGGGGGCGTGCACTGGCTGGCCATGGCCTGGAACCCCCGCTCAAAAACGTTTTACATGTTTGACCCCTTTGGATTTTCAGACAGTAAGCTCAAGCAAGTGTACAGCTTTGAGTATGAGGGCCTACTCAGGCGCAGCGCCATAGCCTCCAGCCCGGATAGGTGTGTCACTTTGGCCAAAAGCAATGAAACCATTCAGGGTCCCAATAGCGCCGCCTGTGGACTGTTTTGTTGTATGTTTTTGCATGCCTTTGTCAACTGGCCTGACGACCCCTTTGACCACAATCCCACCATGGGACCCCTCAAGAGCGTGCCTAACTACAAACTCAATGATCCCACAGTGCAGTATGTGCTCTGGGGAAATCAAGAAAAGCTGTATAAGTTTTTGGAAAAACACTCTGCTTACTTTCGCGCCCACGCCGCTGCAATTAAAGCCAGGACTGCTTTTAATAAATTGAAA
TRN  10010101100011001
NAM  ADEN_ADEP3/19-201
ASQ  RFLGTFDKSFPGFLQESQRCCAIVNTAARHTGGRHWLAVAWEPASRTFYFFDPFGFSDRELAQVYDFEYQRLLRKSAIQSTPDRCLTLVKSTQSVQGPHSAACGLFCLLFLAAFARYPDSPMAYNPVMDLVEGVDNERLFDADVQPIFRANQEACYAFLARHSAYFRAHRHAIMEQTHLHKAL
DSQ  CGCTTCCTGGGCACCTTTGACAAGTCCTTCCCGGGCTTCTTGCAAGAGTCCCAGCGCTGCTGCGCCATCGTCAACACGGCCGCCCGCCACACCGGAGGCCGCCACTGGCTGGCCGTCGCCTGGGAGCCCGCCTCGCGCACCTTCTACTTCTTTGACCCCTTCGGCTTCTCCGACCGGGAGCTCGCCCAGGTCTATGACTTTGAGTACCAGCGCCTGCTGCGCAAGAGCGCCATCCAGAGCACCCCGGACCGCTGCCTCACGCTCGTCAAGAGCACCCAGAGCGTGCAGGGACCGCACAGCGCCGCCTGCGGACTCTTCTGCCTCCTCTTCCTCGCCGCCTTTGCCCGCTACCCCGACAGCCCCATGGCCTACAATCCCGTCATGGACCTGGTGGAGGGCGTGGACAACGAGCGGCTCTTCGACGCCGACGTCCAGCCCATCTTCCGCGCCAACCAGGAGGCCTGCTACGCGTTCCTCGCTCGCCACTCCGCCTACTTCCGCGCCCACCGCCACGCCATCATGGAACAGACACACCTGCACAAAGCGCTC
TRN  11011101101011011
NAM  ADEN_ADEE2/20-201
ASQ  LLLGTYDKRFPGFVSKAKP-CPIVNTAFGETGGEHWIAMAWYPPNNSFYMFDPFGFSDQKLKQIYDFEYQGLLRRSALTSSKDRCVQLIRSTDTVQGPNSAGCGLFGGLFLKSFACNPARPRNGNPIIDIVRGVPNERFTDPSSLPILYRNQENMYAFLENNSPYFVSHEREIKRKTAFDYIQ
DSQ  TTACTGCTTGGGACCTATGATAAGAGGTTTCCTGGCTTTGTCAGTAAAGCGAAGCCT---TGCCCCATCGTCAACACTGCGTTTGGCGAAACTGGAGGCGAACACTGGATAGCGATGGCTTGGTATCCGCCAAATAACTCCTTTTACATGTTTGATCCGTTTGGGTTTTCCGACCAGAAACTGAAACAAATTTACGACTTTGAATACCAAGGCCTGCTTCGACGCAGCGCTTTAACTTCCTCTAAAGACCGCTGCGTTCAACTCATACGTAGTACAGACACCGTTCAAGGCCCTAACAGCGCAGGCTGTGGTCTTTTTGGTGGTTTGTTTTTAAAATCGTTCGCCTGCAATCCTGCCCGCCCGAGGAATGGAAATCCCATAATCGACATAGTACGTGGTGTACCCAACGAGCGTTTCACCGATCCATCGAGCCTACCTATACTCTACAGGAATCAAGAGAACATGTACGCTTTTTTGGAAAATAATTCCCCATACTTTGTATCGCACGAACGCGAAATTAAACGCAAAACTGCTTTTGATTATATTCAA
TRN  10010101100011010
NAM  ADEN_ADEB7/21-199
ASQ  GFLGTFDCRFPGFINKVKVQTAIINTGPREQGGIHWIALAWDPKSYQMFIFDPLGWKNDQLMKYYKFSYSNLIKRSALS-SPDKCVKVIKNSQSVQCTCAGSCGLFCVFFLYCFYKYKSNAFKNCLFQSLYGSIPSLTPPNP---TNLHKNQDFLYKFFKEKSLYFRQNEEYIVSNTKIGLIK
DSQ  GGCTTTTTGGGCACTTTTGATTGTAGATTTCCAGGGTTTATAAACAAAGTTAAAGTGCAAACTGCTATCATAAATACTGGACCGCGTGAACAAGGTGGAATTCATTGGATAGCTTTGGCATGGGATCCTAAAAGTTATCAAATGTTTATTTTTGACCCTTTAGGATGGAAAAATGATCAACTAATGAAATATTACAAATTTTCTTATAGCAATTTAATTAAGCGTTCCGCTCTATCT---TCTCCAGATAAATGTGTAAAAGTTATAAAAAACAGTCAAAGTGTACAATGTACATGTGCCGGATCTTGTGGGTTATTCTGTGTCTTTTTTCTTTACTGTTTTTACAAATATAAAAGTAATGCTTTTAAAAATTGTTTATTTCAATCTCTTTATGGTTCAATACCTTCTTTGACTCCCCCAAATCCC---------ACCAATCTCCACAAAAACCAAGATTTTCTGTATAAATTTTTTAAAGAAAAAAGCCTTTATTTTAGACAGAATGAAGAATATATTGTATCCAATACAAAAATTGGCTTAATAAAA
TRN  10010101100011000
NAM  ADEN_ADEO7/21-199
ASQ  GFLGIFDCRFPGFLQKSKIQTAIINTGPREQGGIHWITLALEPISYKLFIFDPLGWKDTQLIKFYNFSLNSLIKRSALN-NSDRCITVERNTQSVQCTCAGSCGLFCIFFLYCFHFYKQNVFKSWLFQKLNGSTPSLIPCEP---HLLHENQTFLYDFLNAKSVYFRKNYRTFIENTKTGLIK
DSQ  GGATTTTTGGGCATTTTTGATTGCAGATTTCCAGGTTTTCTGCAAAAATCTAAAATTCAAACTGCTATTATTAATACAGGTCCCAGAGAACAAGGCGGAATACACTGGATAACATTAGCATTAGAACCCATTTCTTATAAGCTATTTATATTTGATCCACTCGGATGGAAAGACACTCAATTAATTAAATTTTATAATTTTTCACTAAATTCTCTTATTAAAAGGTCGGCCTTAAAT---AACTCAGACAGATGTATTACAGTAGAAAGAAATACTCAAAGTGTTCAATGTACCTGTGCGGGATCGTGCGGCTTGTTTTGTATATTTTTCTTATACTGTTTTCACTTTTATAAACAAAATGTATTTAAAAGTTGGCTTTTTCAAAAATTAAACGGTTCAACCCCTTCTCTGATCCCATGTGAACCA---------CATCTATTACATGAAAACCAGACATTTCTTTATGATTTTTTAAATGCAAAAAGTGTTTATTTTCGAAAAAATTATAGAACATTTATTGAAAATACTAAGACTGGATTAATAAAA
TRN  10010101100011000
NAM  P87664_9ADEN/21-199
ASQ  NFLGTFDCTFPGFINKHKRQTAIINTGSRASGGLHWLAFAWDPLRYTIYMFDPLGWKEKDLFKLYGFSYKTMIKRSALQ-SDNRCVKLVKNTEAVQCTCAGSCGLFCVFFLYCFNLCHINPFEASIFQAMHGTSPALYPSKP---HLLHANQQMLYDFLRSHSSYFVNNERTLVCNTKLNLIN
DSQ  AATTTTCTCGGGACTTTCGACTGTACATTTCCTGGTTTTATTAACAAACATAAACGCCAAACGGCAATCATTAATACCGGCTCTCGGGCAAGCGGCGGTTTACATTGGCTTGCGTTTGCGTGGGACCCGCTTCGTTACACCATTTACATGTTTGATCCTTTGGGATGGAAAGAAAAGGATCTTTTCAAACTTTATGGGTTTTCCTATAAGACTATGATTAAGCGGTCAGCTTTACAG---AGTGACAACAGATGTGTAAAACTTGTAAAAAATACTGAAGCTGTACAGTGTACTTGCGCTGGTAGTTGTGGTTTATTTTGTGTATTTTTTCTGTATTGTTTTAACTTGTGTCACATTAATCCCTTTGAAGCTTCTATATTTCAAGCTATGCATGGTACCTCCCCGGCTTTGTATCCTTCCAAACCT---------CATCTGTTGCATGCTAATCAGCAAATGTTATACGATTTTCTTCGCTCGCACAGTTCCTATTTTGTAAATAATGAACGCACACTGGTTTGCAATACTAAACTCAATTTAATAAAC
TRN  10010101100011000
//