EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00737 - PsbH)
FAM  PF00737
PID  PsbH
DES  Photosystem II 10 kDa phosphoprotein
IPR  IPR001056
ANO  16
ALN  52
AID  0.741462
APH  (((((((((PSBH_TOBAC/15-66:0.00000,(PSBH_SPIOL/15-66:0.00000,PSBH_PINTH/15-66:0.11015):0.06034):0.01880,((PSBH_HORVU/15-66:0.01961,(PSBH_WHEAT/15-66:0.00000,PSBH_MAIZE/15-66:0.00000):0.00000):0.05914,PSBH_ORYSA/15-66:0.04639):0.03561):0.03697,PSBH_OENHO/15-66:0.04999):0.05741,PSBH_MARPO/15-66:0.12932):0.10189,(PSBH_EUGGR/16-67:0.22932,PSBH_CHLRE/22-73:0.21584):0.10750):0.06063,PSBH_PROHO/4-55:0.28477):0.06257,PSBH_CYAPA/4-55:0.06524):0.05817,PSBH_PORPU/4-55:0.06683):0.02124,PSBH_SYNY3/3-54:0.07366,PSBH_ODOSI/4-55:0.09580);
ATP  (((((((((PSBH_TOBAC/15-66,(PSBH_SPIOL/15-66,PSBH_PINTH/15-66)),((PSBH_HORVU/15-66,(PSBH_WHEAT/15-66,PSBH_MAIZE/15-66)),PSBH_ORYSA/15-66)),PSBH_OENHO/15-66),PSBH_MARPO/15-66),(PSBH_EUGGR/16-67,PSBH_CHLRE/22-73)),PSBH_PROHO/4-55),PSBH_CYAPA/4-55),PSBH_PORPU/4-55),PSBH_SYNY3/3-54,PSBH_ODOSI/4-55);
ATL  2.08011
DNO  16
DLN  156
DID  0.705395
DPH  (((((((((PSBH_TOBAC/15-66:0.04493,(((PSBH_HORVU/15-66:0.00634,PSBH_WHEAT/15-66:0.00000):0.03457,PSBH_MAIZE/15-66:0.02083):0.03409,PSBH_ORYSA/15-66:0.00869):0.09300):0.01659,PSBH_SPIOL/15-66:0.07843):0.04176,PSBH_OENHO/15-66:0.04350):0.03454,PSBH_PINTH/15-66:0.11900):0.06563,PSBH_MARPO/15-66:0.12455):0.11073,(PSBH_EUGGR/16-67:0.23621,PSBH_CHLRE/22-73:0.26486):0.08040):0.05563,(PSBH_PROHO/4-55:0.33151,PSBH_SYNY3/3-54:0.12804):0.17118):0.05439,PSBH_CYAPA/4-55:0.12479):0.05914,PSBH_PORPU/4-55:0.11416,PSBH_ODOSI/4-55:0.12354);
DTP  (((((((((PSBH_TOBAC/15-66,(((PSBH_HORVU/15-66,PSBH_WHEAT/15-66),PSBH_MAIZE/15-66),PSBH_ORYSA/15-66)),PSBH_SPIOL/15-66),PSBH_OENHO/15-66),PSBH_PINTH/15-66),PSBH_MARPO/15-66),(PSBH_EUGGR/16-67,PSBH_CHLRE/22-73)),(PSBH_PROHO/4-55,PSBH_SYNY3/3-54)),PSBH_CYAPA/4-55),PSBH_PORPU/4-55,PSBH_ODOSI/4-55);
DTL  2.62102
RID  0.741462
RPH  (((((((((PSBH_TOBAC/15-66:0.00000,(PSBH_SPIOL/15-66:0.00000,PSBH_PINTH/15-66:0.11015):0.06034):0.01880,((PSBH_HORVU/15-66:0.01961,(PSBH_WHEAT/15-66:0.00000,PSBH_MAIZE/15-66:0.00000):0.00000):0.05914,PSBH_ORYSA/15-66:0.04639):0.03561):0.03697,PSBH_OENHO/15-66:0.04999):0.05741,PSBH_MARPO/15-66:0.12932):0.10189,(PSBH_EUGGR/16-67:0.22932,PSBH_CHLRE/22-73:0.21584):0.10750):0.06063,PSBH_PROHO/4-55:0.28477):0.06257,PSBH_CYAPA/4-55:0.06524):0.05817,PSBH_PORPU/4-55:0.06683):0.02124,PSBH_SYNY3/3-54:0.07366,PSBH_ODOSI/4-55:0.09580);
RTP  (((((((((PSBH_TOBAC/15-66,(PSBH_SPIOL/15-66,PSBH_PINTH/15-66)),((PSBH_HORVU/15-66,(PSBH_WHEAT/15-66,PSBH_MAIZE/15-66)),PSBH_ORYSA/15-66)),PSBH_OENHO/15-66),PSBH_MARPO/15-66),(PSBH_EUGGR/16-67,PSBH_CHLRE/22-73)),PSBH_PROHO/4-55),PSBH_CYAPA/4-55),PSBH_PORPU/4-55),PSBH_SYNY3/3-54,PSBH_ODOSI/4-55);
RTL  2.08011
LNK  PSBH_CHLRE/22-73:P22666:L13303
LNK  PSBH_CYAPA/4-55:P48105:U30821
LNK  PSBH_EUGGR/16-67:P31555:X70810
LNK  PSBH_HORVU/15-66:P12363:X14107
LNK  PSBH_MAIZE/15-66:P24993:X05422
LNK  PSBH_MARPO/15-66:P12160:X04465
LNK  PSBH_ODOSI/4-55:P49475:Z67753
LNK  PSBH_OENHO/15-66:P19820:X55899
LNK  PSBH_ORYSA/15-66:P09449:X12695
LNK  PSBH_PINTH/15-66:P41627:D17510
LNK  PSBH_PORPU/4-55:P51325:U38804
LNK  PSBH_PROHO/4-55:P31095:X60314
LNK  PSBH_SPIOL/15-66:P05146:X07106
LNK  PSBH_SYNY3/3-54:P14835:X17687
LNK  PSBH_TOBAC/15-66:P06415:Z00044
LNK  PSBH_WHEAT/15-66:P04965:X04710
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PSBH_TOBAC/15-66
ASQ  RTAVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLL
DSQ  CGAACTGCGGTAGGAGATTTATTAAAACCATTGAATTCGGAATATGGTAAAGTAGCTCCTGGGTGGGGAACTACTCCTTTGATGGGTGTCGCAATGGCCTTATTTGCGGTATTTCTATCTATTATTTTGGAGATTTATAATTCTTCCGTTTTATTG
TRN  11011101111011010
NAM  PSBH_SPIOL/15-66
ASQ  PTTVGALLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLL
DSQ  CCTACTACTGTAGGGGCTTTATTGAAACCGTTGAATTCGAAATATGGTAAAGTAGCTCCTAGGTGGGGAACTACTCCTTTGATGGGAGTTGCAATGGCTTTATTTGCAGTATTCTTATCTATTATTTTGGAAATTTATAATTCGTCCGTTTTACTG
TRN  00000000001000000
NAM  PSBH_ORYSA/15-66
ASQ  QTRVGNLLKPLNSEYGKVAPGWGTTPFMGVAMALFAVFLSIILEIYNSSVLL
DSQ  CAAACTCGCGTAGGTAATTTATTGAAACCCTTGAATTCGGAATATGGGAAAGTAGCTCCGGGTTGGGGGACTACTCCTTTTATGGGGGTCGCAATGGCTTTATTCGCGGTATTCCTATCTATTATTTTAGAAATTTATAATTCTTCCGTTTTACTG
TRN  11011101101011010
NAM  PSBH_OENHO/15-66
ASQ  KTGLGGLLKPLNSEYGKVAPGWGTTPLMGLAMALFAVFLSIILEIYNSSVLL
DSQ  AAAACAGGTTTAGGGGGGTTATTGAAACCATTAAATTCAGAATATGGTAAAGTAGCTCCTGGGTGGGGAACTACCCCTTTGATGGGTCTTGCAATGGCTCTATTTGCGGTATTCTTATCTATTATTTTGGAAATTTATAATTCTTCCGTTTTATTG
TRN  11011101111011000
NAM  PSBH_PINTH/15-66
ASQ  ETLVGTTLKPLNSEYGKVAPGWGTTPLMGFAMALFAVFLSIILEIYNSSVLL
DSQ  GAAACCCTTGTAGGAACGACCTTAAAACCGCTTAATTCAGAATATGGTAAAGTAGCTCCTGGATGGGGAACTACTCCTCTTATGGGTTTTGCAATGGCTCTATTTGCAGTATTCCTATCTATTATCTTGGAGATTTATAATTCTTCCGTTTTATTG
TRN  11011101111011000
NAM  PSBH_MAIZE/15-66
ASQ  RTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSVLL
DSQ  CGGACTGGCGCAGGTAGTTTATTGAAACCCTTGAATTCGGAATATGGGAAAGTTGCTCCGGGTTGGGGGACTACTCCTTTTATGGGGGTCGCAATGGCTTTATTCGCGATATTCCTATCTATAATTTTAGAAATTTATAATTCTTCTGTTTTACTG
TRN  10010101100011010
NAM  PSBH_WHEAT/15-66
ASQ  RTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSVLL
DSQ  CGAACTGGTGCAGGTAGTTTACTGAAACCCTTGAATTCGGAATATGGGAAAGTCGCCCCGGGTTGGGGGACTACTCCTTTTATGGGGGTCGCAATGGCTTTATTCGCTATATTCCTATCTATCATTTTAGAAATTTATAATTCTTCCGTTTTACTG
TRN  10010101100011010
NAM  PSBH_HORVU/15-66
ASQ  RTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSILL
DSQ  CGAACTGGTGCAGGTAGTTTACTGAAACCCTTGAATTCGGAATATGGGAAAGTCGCCCCGGGTTGGGGGACTACTCCTTTTATGGGGGTCGCAATGGCTTTATTCGCTATATTCCTATCTATCATTTTAGAAATTTATAATTCTTCCATTTTACTG
TRN  10010101100011010
NAM  PSBH_MARPO/15-66
ASQ  KSGIGDILKPLNSEYGKVAPGWGTTPLMGIMMALFAVFLVVILELYNSSVLL
DSQ  AAAAGTGGTATAGGTGATATATTAAAACCATTAAATTCAGAGTATGGAAAAGTGGCTCCTGGTTGGGGAACTACTCCTCTTATGGGTATTATGATGGCTCTTTTTGCAGTTTTTTTAGTTGTTATTTTAGAACTTTATAATTCCTCTGTTTTGTTA
TRN  10010101110011000
NAM  PSBH_SYNY3/3-54
ASQ  RTRLGDILRPLNSEYGKVVPGWGTTPVMGVFMALFLVFLLIILQIYNSSLIL
DSQ  CGCACTCGGTTAGGAGATATCCTCAGACCCCTCAACTCGGAATACGGTAAGGTCGTACCGGGCTGGGGCACCACTCCTGTCATGGGGGTATTTATGGCTCTTTTTCTGGTTTTCTTACTGATTATTTTGCAGATTTATAACTCTTCTCTGATTCTC
TRN  10010101100011010
NAM  PSBH_ODOSI/4-55
ASQ  RTRLGEILRPLNAEYGKVAPGWGTTPIMGVVMLAFLVFLLIILQIYNSSLII
DSQ  AGAACAAGATTAGGCGAAATTTTACGCCCATTAAATGCAGAGTATGGTAAGGTTGCTCCAGGTTGGGGAACAACTCCAATTATGGGAGTGGTAATGTTAGCATTTTTAGTATTTTTATTAATTATTTTACAAATTTATAATTCATCTTTAATTATT
TRN  10110101110011000
NAM  PSBH_PORPU/4-55
ASQ  RTRLGEILRPLNSEYGKVAPGWGTTPIMGIFMLLFFLFLLIILQIYNSSLVL
DSQ  AGAACTAGACTGGGAGAAATTTTAAGACCTTTAAATTCAGAATACGGAAAAGTTGCTCCAGGTTGGGGTACAACTCCTATTATGGGAATTTTCATGTTATTATTTTTCTTATTTTTATTAATAATTTTACAAATATATAATTCATCACTAGTGCTA
TRN  10010101100011000
NAM  PSBH_CYAPA/4-55
ASQ  RTALGNILRPLNSEYGKVAPGWGTTPLMAVFMLLFFVFLLIIIQIYNSSLLL
DSQ  AGAACTGCATTAGGAAATATTCTTAGACCTTTAAATTCTGAGTATGGGAAAGTAGCTCCAGGTTGGGGAACAACCCCATTAATGGCTGTATTTATGTTATTATTTTTTGTATTTTTATTAATTATTATCCAAATTTATAATTCTTCTCTTTTATTA
TRN  10010101110011010
NAM  PSBH_CHLRE/22-73
ASQ  VTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLIL
DSQ  GTTACACCATTAGGTACTTTATTACGTCCACTTAACTCAGAAGCAGGTAAAGTATTACCAGGCTGGGGTACAACTGTTTTAATGGCTGTATTTATCCTTTTATTTGCAGCATTCTTATTAATCATTTTAGAAATTTACAACAGTTCTTTAATTTTA
TRN  11011101111011000
NAM  PSBH_EUGGR/16-67
ASQ  TTTLGTILKPLNSKYGKVLPGWGTAGIMLIFMTLFAIFLTIILEIYNSSVIL
DSQ  ACAACTACTTTAGGAACAATATTAAAACCTTTAAATTCTAAATATGGAAAAGTTCTTCCTGGCTGGGGGACAGCTGGAATAATGTTAATTTTTATGACTTTATTCGCAATTTTTTTAACAATAATTTTAGAAATATACAACTCTTCAGTAATTCTT
TRN  10010101110011000
NAM  PSBH_PROHO/4-55
ASQ  KTALSNFLKPFNSNAGKVVPGWGTTPLMGLFMGLLFVFLLIILQIYNSTIVL
DSQ  AAAACTGCTCTAAGTAATTTTCTCAAACCCTTTAACTCCAACGCAGGTAAAGTGGTACCGGGCTGGGGAACCACTCCCCTGATGGGCCTGTTCATGGGTCTTCTCTTTGTTTTTCTGCTGATCATTCTTCAGATCTACAACTCCACCATCGTCTTA
TRN  11011101101011010
//