EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00731 - AIRC)
FAM  PF00731
PID  AIRC
DES  AIR carboxylase
IPR  IPR000031
ANO  13
ALN  160
AID  0.461903
APH  ((PUR6_SCHPO/386-542:0.17348,(PUR6_DEBOC/393-549:0.14066,PUR6_YEAST/403-559:0.11036):0.11529):0.08169,PUR6_VIGAC/389-545:0.26027,((((PUR6_CAEEL/269-422:0.39778,PUR6_CHICK/267-421:0.45889):0.92321,(PUR6_METSM/3-158:0.20452,PUR6_METTH/3-158:0.38205):0.28007):0.35234,(PUR6_BACSU/3-161:0.17415,(PUR6_BRUME/3-161:0.31239,(PUR6_ECOLI/7-165:0.11249,PUR6_HAEIN/5-163:0.17189):0.14652):0.13228):0.09565):0.08451,PUR6_MYCLE/5-161:0.33373):0.12816);
ATP  ((PUR6_SCHPO/386-542,(PUR6_DEBOC/393-549,PUR6_YEAST/403-559)),PUR6_VIGAC/389-545,((((PUR6_CAEEL/269-422,PUR6_CHICK/267-421),(PUR6_METSM/3-158,PUR6_METTH/3-158)),(PUR6_BACSU/3-161,(PUR6_BRUME/3-161,(PUR6_ECOLI/7-165,PUR6_HAEIN/5-163)))),PUR6_MYCLE/5-161));
ATL  5.57238
DNO  11
DLN  480
DID  0.509834
DPH  ((((((PUR6_ECOLI/7-165:0.24382,PUR6_HAEIN/5-163:0.20541):0.16958,PUR6_MYCLE/5-161:0.40520):0.05639,PUR6_BACSU/3-161:0.21555):0.10161,(PUR6_SCHPO/386-542:0.26492,(PUR6_VIGAC/389-545:0.28862,(PUR6_DEBOC/393-549:0.17285,PUR6_YEAST/403-559:0.23102):0.09713):0.06651):0.10140):0.24415,PUR6_CHICK/267-421:0.82828):0.15843,PUR6_METSM/3-158:0.20284,PUR6_METTH/3-158:0.38016);
DTP  ((((((PUR6_ECOLI/7-165,PUR6_HAEIN/5-163),PUR6_MYCLE/5-161),PUR6_BACSU/3-161),(PUR6_SCHPO/386-542,(PUR6_VIGAC/389-545,(PUR6_DEBOC/393-549,PUR6_YEAST/403-559)))),PUR6_CHICK/267-421),PUR6_METSM/3-158,PUR6_METTH/3-158);
DTL  4.43387
RID  0.486828
RPH  (((((PUR6_MYCLE/5-161:0.33894,(PUR6_VIGAC/389-545:0.26600,(PUR6_SCHPO/386-542:0.16809,(PUR6_DEBOC/393-549:0.13975,PUR6_YEAST/403-559:0.11082):0.11795):0.07959):0.12308):0.14123,PUR6_BACSU/3-161:0.19981):0.05232,(PUR6_ECOLI/7-165:0.13063,PUR6_HAEIN/5-163:0.14276):0.20268):0.31945,PUR6_CHICK/267-421:1.38723):0.27366,PUR6_METSM/3-158:0.21544,PUR6_METTH/3-158:0.36808);
RTP  (((((PUR6_MYCLE/5-161,(PUR6_VIGAC/389-545,(PUR6_SCHPO/386-542,(PUR6_DEBOC/393-549,PUR6_YEAST/403-559)))),PUR6_BACSU/3-161),(PUR6_ECOLI/7-165,PUR6_HAEIN/5-163)),PUR6_CHICK/267-421),PUR6_METSM/3-158,PUR6_METTH/3-158);
RTL  4.77749
LNK  PUR6_BACSU/3-161:P12044:J02732
LNK  PUR6_BRUME/3-161:P52558:
LNK  PUR6_CAEEL/269-422:Q10457:
LNK  PUR6_CHICK/267-421:P38024:M31764
LNK  PUR6_DEBOC/393-549:P50504:U23210
LNK  PUR6_ECOLI/7-165:P09028:X12982
LNK  PUR6_HAEIN/5-163:P43849:U32835
LNK  PUR6_METSM/3-158:P22348:X02586
LNK  PUR6_METTH/3-158:P41654:X03250
LNK  PUR6_MYCLE/5-161:P46702:U00012
LNK  PUR6_SCHPO/386-542:P15567:M37264
LNK  PUR6_VIGAC/389-545:P55195:L22584
LNK  PUR6_YEAST/403-559:P21264:M59824
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PUR6_YEAST/403-559
ASQ  PLVGIIMGSDSDLPVMSAACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIK-TIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSCLDGVDSLHSIVQMPRGVPVATVAIN--NSTNAALLAVRLLGAYDSSYTTKMEQFLLKQEEEVLVKAQKL
DSQ  CCATTGGTTGGAATCATCATGGGATCAGACTCTGACTTGCCGGTAATGTCTGCCGCATGTGCGGTTTTAAAAGATTTTGGCGTTCCATTTGAAGTGACAATAGTCTCTGCTCATAGAACTCCACATAGGATGTCAGCATATGCTATTTCCGCAAGCAAGCGTGGAATTAAA---ACAATTATCGCTGGAGCTGGTGGGGCTGCTCACTTGCCAGGTATGGTGGCTGCAATGACACCACTTCCTGTCATCGGTGTGCCCGTAAAAGGTTCTTGTCTAGATGGAGTAGATTCTTTACATTCAATTGTGCAAATGCCTAGAGGTGTTCCAGTAGCTACCGTCGCTATTAAT------AATAGTACGAACGCTGCGCTGTTGGCTGTCAGACTGCTTGGCGCTTATGATTCAAGTTATACAACGAAAATGGAACAGTTTTTATTAAAGCAAGAAGAAGAAGTTCTTGTCAAAGCACAAAAGTTA
TRN  10010101100011000
NAM  PUR6_DEBOC/393-549
ASQ  PLVSIIMGSDSDLPVMSVGANILKRFGVPFELTIVSAHRTPHRMTQYAIEAPKRGLK-VIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPVATVAIN--NSTNAALLAVRILGAYDYKWLNEMNQYMNNMENEVLAKAERL
DSQ  CCCTTAGTCAGTATAATAATGGGTTCAGATTCAGACTTGCCAGTTATGTCTGTTGGTGCAAACATTTTAAAGAGGTTTGGAGTTCCATTTGAATTAACTATCGTTAGTGCGCATAGAACACCTCATAGAATGACACAATATGCTATTGAAGCACCAAAGAGAGGCTTAAAA---GTCATAATTGCTGGTGCAGGTGGTGCTGCTCATTTACCAGGTATGGTTGCTGCCATGACACCATTACCAGTTATTGGCGTTCCTGTGAAAGGCTCGACTTTAGATGGTGTTGATTCATTGCATTCAATCGTTCAAATGCCAAGGGGTATTCCTGTTGCAACTGTCGCAATTAAT------AACAGTACTAATGCTGCCTTGTTGGCAGTCCGTATTTTGGGAGCCTACGACTACAAGTGGTTAAATGAGATGAACCAGTATATGAATAACATGGAAAACGAAGTGTTAGCTAAAGCTGAAAGATTG
TRN  10010101110011000
NAM  PUR6_SCHPO/386-542
ASQ  PVVGIIMGSDSDLSKMKDAAVILDEFKVPYELTIVSAHRTPDRMVTYARTAASRGLR-VIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGVPVATVAIN--NSQNAGILACRILATFQPSLLAAMESFMDNMKEIVLEKADKL
DSQ  CCTGTTGTTGGTATTATCATGGGTTCGGATTCTGATTTAAGCAAGATGAAAGATGCTGCCGTCATTTTAGATGAATTCAAGGTGCCTTACGAACTTACTATTGTTTCAGCTCACCGCACACCAGATCGCATGGTTACTTATGCTCGTACCGCAGCTTCAAGAGGGTTGCGT---GTGATTATTGCTGGTGCTGGTGGTGCCGCTCATTTGCCTGGTATGGTTGCTGCAATGACACCTCTTCCAGTAATCGGCGTTCCTGTAAAAGGAAGCACTCTTGACGGAGTTGACTCTCTTCACTCTATTGTTCAGATGCCTCGAGGTGTCCCTGTCGCCACTGTTGCTATCAAT------AATAGCCAAAATGCCGGTATTTTAGCCTGTCGTATACTTGCTACATTTCAACCCTCCCTTTTGGCTGCTATGGAGAGCTTTATGGACAATATGAAAGAGATTGTTTTAGAAAAGGCTGATAAATTA
TRN  10010101110011000
NAM  PUR6_VIGAC/389-545
ASQ  TLLGFIMGSDSDLPVMKSAAEMMEMFGVPHEVRIVSAHRTPELMFCYASSAHERGYQ-VIIAGAGGAAHLPGMVASLTPLPVVGVPVRASTLDGLDSLLSIVQMPRGVPVATVAVN--NATNAGLLAVRMLGVANDNLLSRMSQYQEDQKEAVLREGDKL
DSQ  ACGTTGTTGGGATTCATAATGGGTTCTGATTCAGATCTGCCTGTTATGAAAAGTGCTGCTGAAATGATGGAGATGTTTGGTGTGCCTCATGAGGTAAGAATAGTTTCAGCACACAGGACTCCAGAATTGATGTTTTGTTATGCCTCATCTGCTCACGAACGAGGCTATCAA---GTCATTATTGCTGGTGCTGGTGGTGCAGCTCACTTGCCTGGTATGGTTGCATCCCTCACTCCCTTGCCTGTTGTTGGCGTTCCTGTGCGTGCTTCTACCTTGGACGGACTCGATTCACTCTTGTCAATTGTCCAGATGCCGAGAGGTGTTCCAGTTGCCACTGTTGCAGTTAAT------AATGCAACTAATGCTGGATTGCTGGCAGTGAGGATGTTGGGTGTTGCCAACGATAATCTTCTGTCAAGGATGAGTCAATATCAAGAGGACCAAAAAGAAGCCGTCTTGAGGGAAGGAGATAAATTA
TRN  10010101100011000
NAM  PUR6_MYCLE/5-161
ASQ  PRVGVIMGSDSDWSVMQDAAHALAEFDIPIEVRVVSAHRTPAEMFDYARNAVDRSIA-VIIAGAGGAAHLPGMVASATPLPVIGVPVPLARLDGLDSLLSIVQMPAGVPVATVSIG--GARNAGLLAVRILGSSDLQLRAQLVAFQDRLADTVRAKDADL
DSQ  CCCCGAGTCGGGGTGATCATGGGCAGCGACAGCGACTGGTCGGTGATGCAAGATGCGGCCCATGCACTGGCGGAGTTTGACATCCCGATCGAGGTTCGGGTGGTGTCGGCGCATCGCACCCCTGCTGAGATGTTCGACTATGCGCGCAATGCTGTCGACCGCAGCATCGCG---GTGATCATTGCCGGCGCCGGCGGCGCAGCTCACCTGCCTGGAATGGTCGCTTCCGCGACTCCGCTGCCGGTGATCGGGGTGCCGGTGCCGCTGGCCAGGCTCGACGGCCTGGACTCGCTGCTGTCGATCGTGCAGATGCCAGCGGGAGTTCCGGTTGCCACAGTGTCTATCGGT------GGTGCCCGCAACGCGGGTTTGTTGGCGGTGCGTATTTTGGGATCGTCGGACCTGCAGCTTCGAGCGCAGCTGGTCGCGTTCCAGGACCGGTTGGCCGATACCGTGCGGGCCAAGGATGCGGATTTA
TRN  10010101100011010
NAM  PUR6_HAEIN/5-163
ASQ  AQIAVVMGSKSDWATMQEATQILDELNVPYHVEVVSAHRTPDKLFEFAENAQKNGYK-VIIAGAGGAAHLPGMIAAKTLVPVLGVPVKSSMLSGVDSLYSIVQMPKGIPVGTLAIGPAGAANAGLLAAQILAGWDDALFTRLQAFRENQTNMVLDNPDPR
DSQ  GCACAAATTGCCGTTGTAATGGGTTCCAAAAGCGATTGGGCTACTATGCAAGAGGCAACTCAGATTTTAGATGAATTAAACGTGCCTTATCATGTGGAAGTCGTCTCGGCTCATCGTACGCCTGATAAACTTTTTGAATTTGCTGAAAATGCACAAAAAAATGGCTATAAA---GTAATTATTGCTGGTGCAGGGGGGGCGGCACATTTACCCGGTATGATCGCAGCGAAAACACTTGTGCCAGTGCTGGGGGTGCCAGTAAAAAGTTCTATGTTAAGTGGTGTGGATAGCCTTTATTCAATTGTGCAAATGCCAAAAGGGATTCCTGTCGGAACATTAGCGATTGGCCCTGCGGGTGCGGCAAATGCTGGGTTGTTAGCAGCCCAAATTCTAGCAGGTTGGGATGATGCGTTATTCACTCGCCTACAAGCATTCCGCGAAAATCAAACCAATATGGTATTGGACAATCCTGATCCACGC
TRN  11011101101011000
NAM  PUR6_ECOLI/7-165
ASQ  ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQ-VIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPR
DSQ  GCGCGTGTCGCCATCGTGATGGGGTCCAAAAGCGACTGGGCTACCATGCAGTTCGCCGCCGAAATCTTCGAAATCCTGAATGTCCCGCACCACGTTGAAGTGGTTTCTGCTCACCGCACCCCCGATAAACTGTTCAGCTTCGCCGAAAGCGCCGAAGAGAACGGTTATCAG---GTGATTATTGCGGGCGCAGGCGGCGCAGCGCATCTGCCAGGCATGATTGCCGCCAAAACGCTGGTGCCGGTGCTGGGCGTGCCAGTACAGAGCGCCGCACTGAGCGGTGTCGATAGCCTCTACTCCATCGTACAAATGCCGCGCGGCATTCCGGTGGGTACGCTGGCGATTGGTAAAGCTGGCGCGGCAAACGCGGCGTTACTGGCAGCACAAATTCTTGCGACTCATGATAAAGAACTGCACCAGCGTCTGAATGACTGGCGCAAAGCCCAGACCGACGAAGTGCTGGAAAACCCGGACCCGCGA
TRN  11011101101011010
NAM  PUR6_BRUME/3-161
ASQ  VDVAIIMGSQSDWETMHHAADTLEALGISFDARIVSAHRTPDRLVAFAKGAKAEGFK-VIIAGAGGAAHLPGMAAAMTPLPVFGVPVQSKALSGQDSLLSIVQMPAGIPVGTLAIGRAGAVNAALLAAAVLALYDEALAARLDEWRKAQTESVAERPSNE
NAM  PUR6_BACSU/3-161
ASQ  PLVGIIMGSTSDWETMKHACDILDELNVPYEKKVVSAHRTPDFMFEYAETARERGIK-VIIAGAGGAAHLPGMTAAKTTLPVIGVPVQSKALNGMDSLLSIVQMPGGVPVATTSIGKAGAVNAGLLAAQILSAFDEDLARKLDERRENTKQTVLESSDQL
DSQ  CCGCTAGTAGGAATCATCATGGGAAGCACTTCCGATTGGGAGACAATGAAACACGCATGCGACATACTTGACGAACTCAATGTTCCGTACGAAAAAAAGGTCGTTTCCGCTCACCGGACGCCTGATTTCATGTTTGAATATGCTGAAACTGCTAGAGAAAGAGGCATCAAG---GTGATTATTGCCGGTGCCGGAGGAGCGGCGCATCTGCCAGGGATGACGGCTGCGAAAACAACACTGCCAGTCATTGGAGTTCCGGTTCAGTCCAAGGCGCTGAACGGAATGGATTCACTTCTTTCCATCGTCCAAATGCCTGGAGGCGTGCCTGTTGCGACAACATCCATCGGCAAAGCGGGTGCTGTGAACGCAGGCCTGTTAGCGGCGCAAATTTTGTCAGCATTTGACGAAGACCTTGCCCGTAAGCTGGATGAGAGAAGAGAAAATACAAAACAGACAGTGTTAGAAAGCAGTGATCAGCTT
TRN  10010101100011000
NAM  PUR6_METTH/3-158
ASQ  PRVMILLGSASDFRIAEKAMEIFEELRIPYDLRVASAHRTHEKVKAIVSEAVKAGVE-VFIGIAGLSAHLPGMISANTHRPVIGVPVD-VKLGGLDALFACSQMPFPAPVATVGVD--RGENAAILAAQIIGIGDPGVRERVADLRRGFYERVRRDECQV
DSQ  CCCAGAGTGATGATACTCCTTGGAAGTGCATCTGATTTCAGGATAGCCGAAAAGGCAATGGAAATCTTTGAGGAACTCAGGATACCCTATGACCTGAGGGTTGCCTCAGCCCACAGGACACATGAAAAGGTAAAGGCAATAGTCTCAGAGGCCGTGAAGGCGGGTGTTGAG---GTATTCATAGGAATAGCAGGACTATCAGCCCATCTTCCAGGCATGATATCTGCAAACACCCACAGACCCGTCATAGGGGTCCCTGTTGAC---GTTAAACTTGGAGGGCTCGACGCCCTCTTTGCATGTTCACAGATGCCCTTCCCTGCCCCCGTCGCCACTGTGGGGGTAGAC------AGGGGAGAAAACGCCGCAATACTCGCTGCCCAGATAATAGGGATAGGAGATCCCGGGGTAAGGGAAAGGGTTGCAGATCTAAGGAGAGGTTTCTATGAACGCGTGCGGAGAGATGAATGTCAGGTG
TRN  10010101100011001
NAM  PUR6_METSM/3-158
ASQ  PKVMIILGSGSDIAIAEKSMKILEKLEIPYSLKIASAHRTPDLVRELVVQGTNAGIK-VFIGIAGLAAHLPGAIAAYTHKPVIGVPVD-VKVSGLDALYSSVQMPYPSPVATVGID--RGDNGAILAARILGLYDEEIRKKVLESKEGYRQKVIKNNEEI
DSQ  CCAAAAGTAATGATAATTCTGGGAAGTGGGTCAGATATTGCTATCGCTGAAAAAAGTATGAAGATTTTGGAAAAACTTGAAATACCATATAGTTTGAAAATAGCTTCAGCACATAGAACACCTGATCTTGTAAGAGAACTTGTTGTACAGGGAACCAATGCAGGTATAAAA---GTATTTATTGGAATTGCAGGATTAGCTGCTCATCTTCCAGGAGCAATAGCTGCATATACTCACAAACCGGTTATTGGAGTTCCTGTAGAT---GTTAAAGTTAGCGGACTGGATGCACTATATTCTTCAGTTCAAATGCCTTATCCCTCTCCTGTAGCCACTGTTGGAATTGAT------AGGGGAGATAATGGAGCTATTTTAGCTGCACGAATCCTAGGGCTTTATGACGAGGAAATACGCAAAAAAGTATTGGAATCAAAAGAAGGATATAGACAGAAAGTCATTAAAAACAATGAAGAAATT
TRN  10010101100011000
NAM  PUR6_CHICK/267-421
ASQ  GRVVVLMGSTSDLGHCEKIKKACATFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPL-SSDWGAQDVWSSLRLPSGLGCPTTLSP---E-GAAQFAAQIFGLNNHLVWAKLRSNMLNTWISLKQADKKL
DSQ  GGTAGAGTTGTGGTATTGATGGGATCTACTTCTGACCTTGGCCACTGTGAGAAAATAAAGAAGGCATGTGCAACCTTTGGAATTCCTTGTGAGTTAAGAGTAACCTCCGCTCACAAAGGGCCAGATGAAACTCTGAGGATCAAAGCAGAATATGAAGGAGATGGAATCCCGACTGTGTTTGTTGCAGTAGCTGGCAGAAGCAATGGTTTAGGGCCAGTAATGTCTGGTAACACTGCTTACCCTGTTGTCAACTGTCCTCCCCTC---TCATCTGACTGGGGTGCTCAGGATGTGTGGTCCTCTCTCAGACTGCCCAGTGGTCTTGGCTGTCCTACTACTCTGTCACCT---------GAA---GGAGCTGCTCAGTTTGCTGCCCAGATTTTTGGTTTAAACAACCACTTGGTATGGGCCAAACTGCGATCAAACATGTTAAATACATGGATCTCTTTGAAGCAGGCTGACAAAAAATTG
TRN  10010101100011000
NAM  PUR6_CAEEL/269-422
ASQ  CHVLVIMGSGSDGVFARKISDEAKKFGLETTLKVSSAHKTTSDTLEVIADFEESGVPTVVIAVAGRSNGLGPVIAGNSSLPVINCPPP-SEST-SLDIWSSLRMPNGIGCTTVLDP---S-EAALAAAKILASHNHIVFGKVLTAQLKNQINIYNANRKL
//