EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00726 - IL10)
FAM  PF00726
PID  IL10
DES  Interleukin 10
IPR  IPR000098
ANO  3
ALN  170
AID  0.740355
APH  (IL10_MERUN/5-174:0.14162,IL10_BOVIN/5-174:0.17673,BCRF1_EBV/7-167:0.22089);
ATP  (IL10_MERUN/5-174,IL10_BOVIN/5-174,BCRF1_EBV/7-167);
ATL  0.53924
DNO  3
DLN  510
DID  0.724731
DPH  (IL10_MERUN/5-174:0.10998,IL10_BOVIN/5-174:0.11377,BCRF1_EBV/7-167:0.31662);
DTP  (IL10_MERUN/5-174,IL10_BOVIN/5-174,BCRF1_EBV/7-167);
DTL  0.54037
RID  0.740355
RPH  (IL10_MERUN/5-174:0.14162,IL10_BOVIN/5-174:0.17673,BCRF1_EBV/7-167:0.22089);
RTP  (IL10_MERUN/5-174,IL10_BOVIN/5-174,BCRF1_EBV/7-167);
RTL  0.53924
LNK  BCRF1_EBV/7-167:P03180:V01555
LNK  IL10_BOVIN/5-174:P43480:U00799
LNK  IL10_MERUN/5-174:P47965:L37781
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IL10_MERUN/5-174
ASQ  ALLYCLILLAGVRPSRGEYPRNESNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLQQDFKGYLGCQALSEMIQFYLVEVMPQAENHGPEIKENLNSLGEKLKTLRMQLRRCHRFLPCENKSKAVEQVKNDFNKLQEKGVYKAMNEFDIFINCIEAYMTI
DSQ  GCACTGCTATATTGCCTAATCTTACTGGCTGGAGTCCGGCCCAGCAGAGGCGAGTACCCCCGGAATGAGAGTAACTGCACCCACTTCCCAGTCAGCCAGACCCACATGCTCCGAGAGCTTCGAGCTGCCTTCAGCCAGGTGAAGACTTTCTTTCAAAAGAAGGACCAGTTGGACAACATACTGTTAACGGATTCCTTGCAGCAGGACTTTAAGGGTTACTTGGGTTGCCAAGCCTTATCAGAAATGATCCAGTTTTACCTGGTAGAAGTGATGCCCCAGGCAGAGAACCACGGCCCAGAAATCAAGGAGAACTTGAACTCCCTGGGAGAGAAGTTGAAGACCCTCAGAATGCAGCTGCGGCGCTGTCATCGATTTCTCCCCTGTGAAAATAAGAGCAAGGCTGTGGAACAGGTGAAGAATGATTTTAATAAGCTCCAAGAGAAAGGTGTCTACAAGGCCATGAATGAATTTGACATCTTCATCAACTGCATAGAAGCATACATGACAATC
TRN  10010101100011000
NAM  IL10_BOVIN/5-174
ASQ  ALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGEAKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTT
DSQ  GCACTACTCTGTTGCCTGGTCTTCCTGGCTGGGGTGGCAGCCAGCCGAGATGCGAGCACCCTGTCTGACAGCAGCTGTATCCACTTGCCAACCAGCCTGCCCCACATGCTGCGGGAGCTCCGAGCTGCCTTCGGCGAGGCGAAGACTTTCTTTCAAATGAAGGACCAACTGCACAGCTTACTGTTGACCCAGTCTCTGCTGGATGACTTTAAGGGTTACCTGGGTTGCCAAGCCTTGTCGGAAATGATCCAGTTTTACCTGGAAGAGGTGATGCCACAGGCTGAGAACCACGGGCCTGACATCAAGGAGCACGTGAACTCACTGGGGGAGAAGCTGAAGACCCTGCGGCTGCGGCTGCGGCGCTGTCATCGCTTTCTGCCCTGCGAAAACAAGAGCAAGGCGGTGGAGAAGGTGAAGAGAGTCTTCAGTGAGCTCCAAGAGAGGGGTGTCTACAAAGCCATGAGTGAGTTTGACATCTTCATCAACTACATAGAAACCTACATGACAACG
TRN  10010101100011000
NAM  BCRF1_EBV/7-167
ASQ  VTLQCLVLL---------YLAPECGGTDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTI
DSQ  GTCACTCTGCAGTGCCTGGTGCTGCTT---------------------------TACCTGGCACCTGAGTGTGGAGGTACAGACCAATGTGACAATTTTCCCCAAATGTTGAGGGACCTAAGAGATGCCTTCAGTCGTGTTAAAACCTTTTTCCAGACAAAGGACGAGGTAGATAACCTTTTGCTCAAGGAGTCTCTGCTAGAGGACTTTAAGGGCTACCTTGGATGCCAGGCCCTGTCAGAAATGATCCAATTCTACCTGGAGGAAGTCATGCCACAGGCTGAAAACCAGGACCCTGAAGCCAAAGACCATGTCAATTCTTTGGGTGAAAATCTAAAGACCCTACGGCTCCGCCTGCGCAGGTGCCACAGGTTCCTGCCGTGTGAGAACAAGAGTAAAGCTGTGGAACAGATAAAAAATGCCTTTAACAAGCTGCAGGAAAAAGGAATTTACAAAGCCATGAGTGAATTTGACATTTTTATTAACTACATAGAAGCATACATGACAATT
TRN  10010101100011001
//