EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00687 - Ribosomal_L1)
FAM  PF00687
PID  Ribosomal_L1
DES  Ribosomal protein L1p/L10e family
IPR  IPR002143
ANO  16
ALN  220
AID  0.396174
APH  ((((((((RL1_BACST/14-220:0.15279,RL1_STRGR/14-220:0.35783):0.09947,((RL1_LIBAS/16-222:0.40967,RL1_ECOLI/14-220:0.34874):0.10986,RL1_THEMA/15-222:0.29065):0.04912):0.04926,RL1_MYCGE/15-219:0.63023):0.06686,RL1_THETH/14-221:0.34535):0.08292,((RK1_CYAPA/15-220:0.20383,RL1_SYNY3/16-222:0.16580):0.06981,(RK1_PORPU/15-220:0.25198,RK1_ODOSI/15-221:0.43718):0.07447):0.15982):0.80316,RL10A_RAT/4-212:0.89491):0.28293,(RL1_METJA/1-208:0.24079,RL1_METVA/6-208:0.16992):0.28172):0.50551,RL1_HALSA/5-207:0.12959,RL1_HALMA/2-207:0.10261);
ATP  ((((((((RL1_BACST/14-220,RL1_STRGR/14-220),((RL1_LIBAS/16-222,RL1_ECOLI/14-220),RL1_THEMA/15-222)),RL1_MYCGE/15-219),RL1_THETH/14-221),((RK1_CYAPA/15-220,RL1_SYNY3/16-222),(RK1_PORPU/15-220,RK1_ODOSI/15-221))),RL10A_RAT/4-212),(RL1_METJA/1-208,RL1_METVA/6-208)),RL1_HALSA/5-207,RL1_HALMA/2-207);
ATL  7.81472
DNO  14
DLN  660
DID  0.470997
DPH  ((RL1_STRGR/14-220:0.26180,(((RL1_LIBAS/16-222:0.32488,(((RK1_PORPU/15-220:0.23232,(RK1_CYAPA/15-220:0.17052,RL1_SYNY3/16-222:0.31694):0.05128):0.06866,RK1_ODOSI/15-221:0.28545):0.13709,RL1_MYCGE/15-219:0.36471):0.10783):0.12606,RL1_THEMA/15-222:0.28457):0.14024,RL1_ECOLI/14-220:0.23285):0.19769):0.07402,(RL10A_RAT/4-212:0.51621,((RL1_HALMA/2-207:0.11315,RL1_HALSA/5-207:0.14109):0.14324,RL1_METVA/6-208:0.70686):0.20532):0.27415,RL1_THETH/14-221:0.24349);
DTP  ((RL1_STRGR/14-220,(((RL1_LIBAS/16-222,(((RK1_PORPU/15-220,(RK1_CYAPA/15-220,RL1_SYNY3/16-222)),RK1_ODOSI/15-221),RL1_MYCGE/15-219)),RL1_THEMA/15-222),RL1_ECOLI/14-220)),(RL10A_RAT/4-212,((RL1_HALMA/2-207,RL1_HALSA/5-207),RL1_METVA/6-208)),RL1_THETH/14-221);
DTL  5.72042
RID  0.396614
RPH  ((((((RL1_THETH/14-221:0.34578,RL1_MYCGE/15-219:0.62583):0.07164,(((RL1_LIBAS/16-222:0.39807,RL1_ECOLI/14-220:0.36324):0.08851,RL1_STRGR/14-220:0.37980):0.05900,RL1_THEMA/15-222:0.29593):0.09498):0.06537,((RK1_CYAPA/15-220:0.21033,RL1_SYNY3/16-222:0.16061):0.07524,(RK1_PORPU/15-220:0.25699,RK1_ODOSI/15-221:0.43019):0.06974):0.14466):0.76414,RL10A_RAT/4-212:0.90130):0.33383,RL1_METVA/6-208:0.45182):0.45085,RL1_HALSA/5-207:0.09160,RL1_HALMA/2-207:0.14166);
RTP  ((((((RL1_THETH/14-221,RL1_MYCGE/15-219),(((RL1_LIBAS/16-222,RL1_ECOLI/14-220),RL1_STRGR/14-220),RL1_THEMA/15-222)),((RK1_CYAPA/15-220,RL1_SYNY3/16-222),(RK1_PORPU/15-220,RK1_ODOSI/15-221))),RL10A_RAT/4-212),RL1_METVA/6-208),RL1_HALSA/5-207,RL1_HALMA/2-207);
RTL  7.32271
LNK  RK1_CYAPA/15-220:P48125:U30821
LNK  RK1_ODOSI/15-221:P49544:Z67753
LNK  RK1_PORPU/15-220:P51338:U38804
LNK  RL10A_RAT/4-212:P62907:X93352
LNK  RL1_BACST/14-220:P04447:
LNK  RL1_ECOLI/14-220:P02384:V00339
LNK  RL1_HALMA/2-207:P12738:X51430
LNK  RL1_HALSA/5-207:P05966:X13008
LNK  RL1_LIBAS/16-222:P36248:M94319
LNK  RL1_METJA/1-208:P54050:
LNK  RL1_METVA/6-208:P15824:X16023
LNK  RL1_MYCGE/15-219:P47328:U39689
LNK  RL1_STRGR/14-220:P36256:X72787
LNK  RL1_SYNY3/16-222:P36236:X73005
LNK  RL1_THEMA/15-222:P29393:Z11839
LNK  RL1_THETH/14-221:P27150:X81375
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RL1_THETH/14-221
ASQ  VDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRS-DQNVRGTVSLPHGLGK-QVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGW------MDFDAVVATPDVMGAVGSKLGRILGP----RGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPS
DSQ  GTGGACCCCAACAAGATTTACACCATTGACGAGGCCGCCCATCTCGTGAAGGAGCTCGCCACCGCCAAGTTTGACGAGACGGTGGAGGTCCACGCCAAGCTCGGCATTGACCCCCGCCGCTCC---GACCAGAACGTGCGCGGCACCGTCTCCCTTCCCCACGGCCTCGGCAAG---CAGGTGCGGGTCTTGGCCATCGCCAAGGGGGAGAAGATCAAGGAGGCCGAGGAGGCAGGGGCGGACTACGTGGGCGGCGAGGAGATCATCCAGAAGATCCTAGACGGCTGG------------------ATGGACTTTGACGCCGTGGTGGCCACCCCCGACGTGATGGGGGCCGTGGGCTCTAAACTCGGCCGGATCCTGGGGCCC------------CGGGGCCTCCTCCCCAACCCCAAGGCCGGGACCGTAGGGTTCAACATCGGCGAGATCATCCGGGAGATCAAGGCGGGGCGGATTGAGTTCCGCAACGACAAGACCGGAGCCATCCACGCCCCCGTGGGCAAGGCGAGCTTTCCGCCGGAGAAGCTTGCGGACAACATCCGGGCCTTCATCCGCGCCCTCGAGGCCCACAAGCCGGAAGGGGCCAAGGGCACCTTCCTCCGCTCCGTCTACGTCACCACCACCATGGGCCCCAGC
TRN  11011101101011011
NAM  RL1_THEMA/15-222
ASQ  VDRTKYYDLDEAIELVKKTATAKFDETIELHIQTGIDYRKP-EQHIRGTIVLPHGTGK-EVKVLVFAKGEKAKEALEAGADYVGAEDLVEKIEKEG-----FLDFDVAIATPDMMRIIG-RLGKILGP----RGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIIAAIKQIMQMKPAGVKGQFIKKVVLASTMGPG
DSQ  GTGGACAGAACAAAGTACTACGATCTTGACGAAGCCATAGAACTCGTTAAAAAAACTGCCACGGCGAAATTCGATGAAACGATAGAACTCCACATTCAAACTGGAATAGACTACAGGAAACCT---GAACAGCACATCAGAGGAACGATCGTGCTTCCACACGGGACAGGTAAG---GAAGTCAAGGTTCTGGTGTTTGCCAAAGGTGAAAAGGCAAAAGAGGCTTTGGAAGCGGGCGCGGATTACGTAGGAGCTGAGGATCTTGTAGAAAAAATAGAAAAAGAAGGT---------------TTTCTCGATTTCGATGTGGCAATAGCCACACCTGATATGATGAGAATAATCGGA---AGGCTCGGAAAGATTCTGGGACCA------------AGAGGTTTGATGCCATCGCCCAAATCTGGAACGGTGACTCAGGAAGTAGCAGAAGCGGTTAAAGAGTTTAAAAAAGGAAGAATCGAGGTCAGAACGGACAAAACTGGGAACATCCACATACCCGTTGGTAAGAGGAGCTTCGATAACGAGAAACTGAAGGAAAACATAATCGCGGCAATAAAACAGATTATGCAGATGAAACCCGCAGGTGTGAAAGGACAGTTCATAAAAAAAGTGGTTTTGGCCTCTACAATGGGACCCGGT
TRN  10010101100011011
NAM  RL1_STRGR/14-220
ASQ  VDRERNYAPLEAVRLAKETSSTKFDGTVEVAFALGVDPRKA-DQMVRGTVNLPHGTGK-TARVLVFATGDRAAAAEAAGADIVGADELIDEVAKGR------LDFDAVVATPDLMGKVG-RLGRVLGP----RGLMPNPKTGTVTPDVVKAVNDIKGGKIEFRVDKHSNLHFIIGKVSFDETKLVENYAAALEEILRLKPSAAKGRYIKKATLATTMGPG
DSQ  GTCGACCGGGAGCGCAACTACGCCCCGCTCGAGGCCGTCCGTCTCGCCAAGGAAACCTCGTCCACGAAGTTCGACGGCACCGTCGAGGTCGCCTTTGCCCTGGGTGTCGACCCGCGCAAGGCC---GACCAGATGGTCCGTGGCACCGTGAACCTCCCGCACGGCACCGGCAAG---ACCGCCCGGGTCCTGGTCTTCGCGACCGGTGACCGTGCTGCGGCCGCGGAAGCCGCCGGAGCCGACATCGTCGGCGCCGACGAGCTCATCGACGAGGTGGCGAAGGGCCGT------------------CTGGACTTCGACGCCGTCGTCGCGACCCCGGACCTCATGGGCAAGGTCGGC---CGCCTGGGCCGCGTGCTCGGTCCG------------CGTGGTCTGATGCCGAACCCGAAGACCGGCACCGTCACCCCCGACGTCGTGAAGGCTGTCAACGACATCAAGGGCGGCAAGATCGAGTTCCGCGTCGACAAGCACTCGAACCTGCACTTCATCATCGGCAAGGTCTCCTTCGACGAGACCAAGCTGGTGGAGAACTACGCAGCGGCGCTGGAGGAGATCCTCCGTCTGAAGCCGTCCGCCGCCAAGGGCCGCTACATCAAGAAGGCCACGCTGGCCACCACGATGGGCCCCGGC
TRN  11011111101111111
NAM  RL1_BACST/14-220
ASQ  VDRSKAYPIAEAIELVKKTNVAKFDATVEVAFRLGVDPKKA-DQQIRGAVVLPHGTGK-VARVLVFAKGEKAKEAEAAGADYVGDTEYINKIQQGW------FDFDVVVATPDMMGEVG-KLGRILGP----KGLMPDPKTGTVTFDVAKAVQEIKAGKVEYRVDKAGNIHVPIGKVSFDNEKLAENFAAVYEALIKAKPAAAKGTYVKNVTITSTMGPG
NAM  RL1_ECOLI/14-220
ASQ  VDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDARKS-DQNVRGATVLPHGTGR-SVRVAVFTQGANAEAAKAAGAELVGMEDLADQIKKGE------MNFDVVIASPDAMRVVG-QLGQVLGP----RGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAG
DSQ  GTTGATGCAACCAAACAGTACGACATCAACGAAGCTATCGCACTGCTGAAAGAGCTGGCGACTGCTAAATTCGTAGAAAGCGTGGACGTAGCTGTTAACCTCGGCATCGACGCTCGTAAATCT---GACCAGAACGTACGTGGTGCAACTGTACTGCCGCACGGTACTGGCCGT---TCCGTTCGCGTAGCCGTATTTACCCAAGGTGCAAACGCTGAAGCTGCTAAAGCTGCAGGCGCAGAACTGGTAGGTATGGAAGATCTGGCTGACCAGATCAAGAAAGGCGAA------------------ATGAACTTTGACGTTGTTATTGCTTCTCCGGATGCAATGCGCGTTGTTGGC---CAGCTGGGCCAGGTTCTGGGTCCG------------CGCGGCCTGATGCCAAACCCGAAAGTGGGTACTGTAACACCGAACGTTGCTGAAGCGGTTAAAAACGCTAAAGCTGGCCAGGTTCGTTACCGTAACGACAAAAACGGCATCATCCACACCACCATCGGTAAAGTGGACTTTGACGCTGACAAACTGAAAGAAAACCTGGAAGCTCTGCTGGTTGCGCTGAAAAAAGCAAAACCGACTCAGGCGAAAGGCGTGTACATCAAGAAAGTTAGCATCTCCACCACCATGGGTGCAGGT
TRN  11011101101011011
NAM  RL1_LIBAS/16-222
ASQ  IDRSALYGLSDAVVMLKERATARFDETVEIAMNLGIDPRHA-NQMVRGVVTMPNGTGV-NVRVAVFATSSKADEAREAGADIVGGEDLFEIVKGGQ------IDFDRCIATPDMMPLVG-RLGRILGP----RGIMPNLRVGTVTTDVATAVRESKSGAVDFRSEKAGIIHAGIGKVSFENKKIEENVLAFVSAVVKAKPSVAKGDYVKRVTLSSTMGCG
DSQ  ATTGATCGTTCAGCGTTATATGGGTTAAGTGATGCTGTGGTTATGCTTAAAGAGCGTGCTACGGCTAGGTTTGATGAAACAGTTGAGATAGCAATGAATCTAGGCATTGATCCTCGGCATGCT---AATCAGATGGTTCGTGGCGTTGTTACTATGCCTAATGGCACGGGGGTA---AATGTTCGCGTGGCGGTTTTTGCTACATCTTCGAAGGCGGATGAAGCTAGGGAAGCAGGGGCTGATATTGTTGGAGGAGAAGATCTTTTCGAAATTGTTAAAGGCGGGCAG------------------ATAGATTTTGACCGTTGTATTGCTACACCGGATATGATGCCTTTAGTTGGA---AGGTTGGGTAGGATTTTAGGTCCT------------CGTGGTATTATGCCTAATTTGAGGGTTGGTACGGTGACAACAGATGTTGCTACTGCTGTTCGAGAGTCTAAGAGTGGTGCGGTTGATTTTCGTTCTGAAAAAGCAGGGATTATTCATGCGGGGATAGGTAAGGTTTCTTTCGAGAATAAAAAAATAGAGGAAAATGTTTTGGCTTTTGTTAGTGCTGTTGTAAAGGCGAAACCTTCTGTTGCGAAAGGTGATTACGTAAAGCGTGTTACTTTGTCATCGACTATGGGATGTGGT
TRN  10010101110011000
NAM  RL1_SYNY3/16-222
ASQ  VDDSKLYSPLEAMELLKETATAKFDETAEAHIRLGIDPKYS-DQQIRTTVSLPKGTGQ-TVRVAVLARGEKVKEATDAGADIAGSEELIEEIQKGM------MDFDVLIATPDMMPKIA-RLGKQLGP----RGLMPSPKGGTVTADLAAAVNEFKAGKLEFRADRTGIVHVMFGKASFSADDLLANLKALQETIDRNRPSGAKGRFWRTVFVSSSMGPS
DSQ  GTAGATGACAGCAAACTCTATAGCCCGTTAGAGGCCATGGAGTTGCTCAAGGAAACCGCCACTGCCAAATTTGATGAGACGGCCGAAGCCCACATCCGTCTGGGCATTGATCCCAAATACAGT---GACCAACAAATTCGGACCACTGTTTCTTTACCCAAAGGAACAGGGCAA---ACAGTACGGGTAGCCGTGCTAGCCCGGGGGGAAAAGGTCAAGGAGGCCACCGATGCTGGGGCTGACATTGCCGGTTCTGAGGAATTGATTGAAGAAATTCAAAAGGGCATG------------------ATGGACTTTGACGTGCTCATTGCCACCCCTGATATGATGCCCAAAATTGCC---CGGTTGGGTAAACAATTGGGGCCC------------CGGGGTCTCATGCCTTCTCCCAAGGGGGGAACGGTAACCGCAGACCTGGCCGCGGCGGTAAATGAATTTAAAGCCGGAAAATTAGAATTCCGGGCTGATCGTACGGGCATCGTTCATGTTATGTTTGGAAAGGCCTCTTTTTCCGCCGATGATTTATTGGCGAATTTAAAAGCGCTGCAAGAGACCATTGACCGCAATCGTCCTTCGGGGGCAAAGGGTCGTTTCTGGCGCACCGTATTTGTGTCCAGTTCCATGGGTCCTTCC
TRN  11011101101011010
NAM  RK1_CYAPA/15-220
ASQ  VEEQ-LYEPLEAIQLLKQISTAKFIETVEVHCRLGIDPKYN-DQQLRATVTLPNGTGQ-TLRVAVITRGEKINEASTAGADLVGAEELIDEIQNGR------LDFDCLIATPDMMPQVA-KLGRVLGP----RGLMPSPKGGTVTFDLAQAINDFKAGKLEFRNDRTGIVHVLFGKANFSEEALLGNLKAVQEAVDRNRPSGVKGKYWKSIYITSTMSPS
DSQ  GTTGAAGAACAA---CTATATGAACCATTAGAAGCAATTCAACTTTTAAAACAAATTTCAACAGCAAAATTTATTGAAACGGTTGAAGTACATTGCCGTTTAGGAATCGATCCAAAGTATAAT---GATCAACAATTACGTGCAACAGTAACTCTTCCAAATGGAACTGGTCAA---ACTTTAAGAGTAGCAGTAATTACACGAGGAGAAAAAATTAATGAAGCCTCTACTGCCGGTGCTGATCTTGTTGGTGCTGAAGAATTAATTGATGAAATTCAAAACGGACGT------------------TTAGACTTTGATTGTTTAATTGCTACACCAGATATGATGCCACAAGTGGCA---AAATTAGGACGTGTATTAGGTCCA------------AGAGGACTAATGCCTTCTCCAAAAGGTGGTACTGTTACGTTTGATTTAGCTCAAGCAATTAATGATTTTAAAGCTGGAAAACTTGAATTTAGAAATGATAGAACTGGAATTGTTCACGTTCTATTTGGAAAAGCAAATTTTTCAGAAGAAGCTTTACTTGGAAATTTAAAAGCTGTTCAAGAAGCAGTTGATCGTAATCGTCCTTCTGGTGTTAAAGGAAAATATTGGAAGAGTATTTATATTACTTCTACCATGAGTCCTTCA
TRN  10010101110011000
NAM  RK1_PORPU/15-220
ASQ  VDPK-LYSLNEAVTILRATSNAKFKETAEAHISLGLNPKYA-DQQLRATVILPKGTGK-LVKVAVIAKGEKLTEAMNAGADISGSEELIDEISKGR------LDFDKLIATPDIMPLIA-KLGRVLGP----RGLMPSPKAGTVTLDITKSINEFKGGKVEYRVDRTGIIHVPFGKSSFPEEDLVMNLQTIKDSIDKNKPSGSKGKYWKTFFLSSTMGPS
DSQ  GTTGATCCTAAA---CTGTACAGCTTAAATGAAGCTGTGACTATACTAAGAGCAACATCAAATGCAAAATTCAAAGAGACCGCAGAAGCTCATATTTCTTTAGGTCTAAATCCTAAATATGCA---GACCAACAACTAAGAGCAACAGTTATTTTGCCAAAAGGAACTGGAAAA---TTAGTAAAAGTAGCAGTCATCGCTAAAGGTGAAAAATTAACAGAAGCAATGAATGCTGGGGCCGATATCAGTGGTTCCGAAGAACTGATTGATGAAATTTCTAAAGGCCGA------------------CTAGACTTTGATAAATTAATAGCAACTCCTGATATAATGCCTTTAATTGCA---AAATTAGGAAGAGTGTTAGGACCA------------AGAGGATTAATGCCCTCTCCAAAGGCAGGAACAGTTACTTTAGATATTACAAAGTCTATCAATGAATTTAAGGGTGGTAAAGTTGAATATAGGGTTGACAGAACAGGTATTATTCATGTTCCTTTTGGAAAATCTAGTTTTCCTGAAGAAGATTTAGTTATGAATCTGCAAACAATTAAAGATTCGATTGATAAAAATAAGCCATCTGGCTCAAAAGGTAAATATTGGAAAACATTTTTCCTTTCTAGTACCATGGGACCATCT
TRN  10010101100011000
NAM  RK1_ODOSI/15-221
ASQ  TKDSIYSNLEDAITILQETATAKFTETVELHANLNIDPKYA-DQQLRTTVTLPHGIGK-TINIAVLTNDSNFTEAREAGADRVGSDDLIEEISQGN------ISFDLLIATPDMMPKLA-KLGRVLGP----KGLMPSPKSGTVSTTLTATLSEFKKGKFEYKADKAGVVHVSFGKSNFTHSQLMENLTALYKSIEQNRPSGVKGKYFKSLFICTTMGPS
DSQ  ACTAAAGATAGTATTTATTCAAATCTTGAAGACGCTATTACGATACTTCAAGAAACTGCAACGGCAAAATTTACAGAAACTGTCGAGTTACATGCAAATTTAAATATTGATCCAAAATATGCA---GATCAACAATTGCGTACAACTGTAACCTTACCTCATGGTATTGGTAAG---ACAATTAATATTGCAGTTTTAACAAATGATTCGAATTTTACAGAAGCACGCGAAGCTGGAGCAGATCGAGTTGGAAGTGATGATTTAATTGAGGAAATTAGCCAAGGAAAT------------------ATTAGTTTTGACTTGTTAATAGCAACTCCTGATATGATGCCAAAACTTGCG---AAACTTGGTCGAGTTTTAGGCCCT------------AAAGGATTAATGCCTTCACCAAAATCCGGAACTGTTAGTACAACATTAACAGCTACTTTATCGGAATTTAAAAAAGGTAAATTTGAATATAAGGCCGATAAAGCAGGTGTTGTACATGTTAGTTTTGGAAAATCAAATTTCACTCACTCTCAATTAATGGAGAATTTAACAGCATTATATAAATCTATTGAACAAAATCGACCTTCAGGTGTAAAGGGTAAATATTTTAAAAGTTTATTTATTTGTACAACAATGGGTCCGTCG
TRN  10010101110011000
NAM  RL1_MYCGE/15-219
ASQ  IDKNKLYPIQEAFELIKKTAITKFVSSVDIAVSLNLDTTKA-EQQLRGAIAFPFSIGK-SIRILAITDDE--KKASEAGADFVGGLDKIEAIKNGW------LDFDLIITSPKFMGALG-KLGKLLGT----RGLMPNPKTETVTDDVVSAIKAYKKGKKEYRTDSFGNIHLSLGKTDTKTEHLVANAMALIDLIKSKRPSTVKGTYIKNIALTTTMGPS
DSQ  ATTGATAAAAACAAACTTTATCCTATCCAAGAAGCATTTGAATTAATTAAAAAAACAGCAATTACTAAGTTTGTCAGTTCAGTTGATATTGCTGTTAGTTTAAACCTTGATACTACTAAAGCT---GAACAACAGTTAAGAGGTGCAATTGCTTTTCCTTTTAGTATTGGTAAA---TCTATCAGAATTTTAGCTATCACTGATGATGAG------AAAAAAGCTAGTGAAGCAGGTGCTGATTTTGTTGGTGGGCTTGATAAGATAGAAGCGATAAAAAATGGCTGA------------------TTAGATTTTGATCTAATTATCACTTCTCCCAAGTTCATGGGAGCATTAGGT---AAACTAGGAAAACTATTAGGAACC------------AGGGGATTGATGCCAAACCCAAAAACTGAAACAGTTACTGATGATGTAGTTAGTGCTATTAAAGCTTATAAAAAGGGTAAGAAAGAATATCGAACTGATTCATTTGGCAACATCCACCTCTCTTTAGGTAAAACAGATACCAAAACTGAGCACTTGGTTGCTAATGCCATGGCTTTAATAGATTTAATTAAGTCTAAACGTCCTAGCACAGTCAAAGGTACTTACATTAAAAATATTGCTTTGACAACAACAATGGGACCAAGT
TRN  00010000000000000
NAM  RL1_METVA/6-208
ASQ  -----IQKAVKEART--LAKPRNFTQSVDLIVNLKELDLTRHENRLKEQIVLPSGKGK-DTKIAVIAKGDLAAQAAEMGLTVIRQEELEELGKNKKAAKRIANEHGFFIAQADMMPLVGKSLGPVLGP----RGKMPTPLP--GNANLAPLVARFKK-TVAINTRDKSLFQVYIGTEAMSDEEIAANAEAILNVVAKKYEKG--LYHVKSAFTKLTMGAA
DSQ  ---------------ATACAAAAAGCAGTGAAGGAGGCTCGAACT------CTCGCTAAGCCGCGAAACTTCACACAGTCCGTTGATCTTATTGTAAACTTGAAAGAGTTAGATCTTACAAGACATGAAAACAGGTTGAAAGAACAGATCGTCTTACCTAGCGGAAAAGGTAAG---GACACTAAGATCGCTGTGATTGCAAAAGGTGACTTAGCGGCACAGGCAGCAGAAATGGGCCTCACTGTAATAAGACAGGAAGAATTAGAAGAATTAGGTAAAAATAAAAAAGCAGCTAAAAGAATTGCTAACGAGCACGGATTCTTTATTGCTCAAGCAGACATGATGCCATTGGTAGGTAAATCATTAGGTCCAGTTCTAGGCCCT------------AGGGGTAAAATGCCAACACCATTGCCT------GGAAATGCAAATTTGGCTCCATTGGTTGCTAGATTCAAAAAA---ACAGTAGCCATAAATACAAGGGATAAATCGTTATTCCAAGTATACATTGGAACTGAAGCTATGAGTGATGAAGAAATCGCTGCAAATGCGGAAGCAATTTTAAACGTAGTGGCTAAAAAATACGAAAAAGGC------CTCTACCACGTAAAGAGTGCATTTACAAAACTCACTATGGGTGCAGCA
TRN  10010101110011000
NAM  RL1_METJA/1-208
ASQ  MDREALLQAVKEARE--LAKPRNFTQSFEFIATLKEIDMRKPENRIKTEVVLPHGRGK-EAKIAVIGTGDLAKQAEELGLTVIRKEEIEELGKNKRKLRKIAKAHDFFIAQADLMPLIGRYMGVILGP----RGKMPKPVP--ANANIKPLVERLKK-TVVINTRDKPYFQVLVGNEKMTDEQIVDNIEAVLNVVAKKYEKG--LYHIKDAYVKLTMGPA
NAM  RL1_HALMA/2-207
ASQ  --DQEIENAVSRALE--DAPERNFRETVDLAVNLRDLDLNDPSNRVDESVVLPAGTGQ-ETTIVVFAEGETALRAEEVADDVLDEDELEELGGDDDAAKDLADDTDFFIAEKGLMQDIGRYLGTVLGP----RGKMPEPLD--PDDDVVEVIERMKN-TVQLRSGERRTFHTRVGAEDMSAENIADNIDVILRRLHADLEKG--PLNIDTVYVKTTMGPA
DSQ  ------GATCAGGAAATAGAGAACGCAGTCTCGCGCGCACTCGAG------GACGCACCTGAGCGGAATTTCCGCGAAACGGTCGACCTCGCTGTGAACCTGCGCGACTTAGATCTTAACGACCCGTCGAACCGCGTCGACGAGTCCGTCGTGCTTCCTGCTGGCACCGGTCAG---GAGACCACTATTGTGGTCTTCGCCGAGGGCGAAACCGCCCTTCGTGCCGAGGAAGTCGCAGACGACGTACTCGACGAGGATGAACTCGAGGAACTCGGTGGCGACGACGACGCCGCCAAGGACCTTGCCGATGACACTGACTTCTTCATTGCGGAGAAGGGACTGATGCAGGACATCGGTCGCTACCTCGGGACCGTCCTCGGTCCG------------CGTGGGAAGATGCCGGAACCGCTCGAC------CCCGACGACGACGTCGTCGAGGTCATCGAACGCATGAAAAAC---ACCGTGCAGCTCCGCAGCGGGGAACGGCGAACGTTCCACACGCGGGTCGGCGCGGAGGACATGTCCGCCGAGAATATCGCGGACAACATCGACGTTATCCTCCGCCGTCTGCACGCGGACCTCGAGAAGGGC------CCGCTCAACATCGACACTGTCTACGTGAAGACGACGATGGGGCCTGCG
TRN  10010101100011010
NAM  RL1_HALSA/5-207
ASQ  -----IEEAVARALE--DAPQRNFRETVDLAVNLRDLDLNDPSQRVDEGVVLPSGTGQ-ETQIVVFADGETAVRADDVADDVLDEDDLSDLADDTDAAKDLADETDFFVAEAPMMQDIAGALGQVLGP----RGKMPTPLQ--PDDDVVDTVNRMKN-TVQIRSRDRRTFHTRVGAEDMSAEDIASNIDVIMRRLHANLEKG--PLNVDSVYVKTTMGPA
DSQ  ---------------ATAGAAGAGGCCGTAGCTCGCGCACTTGAG------GATGCCCCACAGCGGAACTTCCGTGAGACGGTAGACCTCGCAGTCAACCTGCGCGACCTCGACCTCAACGACCCGTCGCAACGAGTCGACGAGGGCGTCGTGCTGCCGTCGGGCACCGGACAG---GAGACGCAGATCGTGGTTTTCGCAGACGGCGAAACCGCGGTTCGCGCGGACGACGTCGCTGACGACGTCCTCGACGAGGACGACCTCAGCGACCTCGCAGACGACACCGACGCCGCGAAGGATCTCGCAGACGAGACGGACTTCTTCGTGGCGGAAGCACCCATGATGCAGGACATCGCGGGTGCGCTCGGTCAAGTGCTTGGTCCG------------CGCGGGAAAATGCCGACCCCGCTCCAG------CCCGACGACGACGTCGTCGACACAGTCAACCGCATGAAAAAC---ACCGTGCAGATCCGCAGCCGCGACCGCCGCACGTTCCACACGCGCGTCGGCGCGGAGGACATGTCCGCCGAGGACATCGCCAGCAACATCGACGTCATCATGCGTCGGCTGCACGCGAACCTCGAAAAAGGC------CCGCTGAACGTGGACTCCGTCTACGTGAAGACAACGATGGGGCCTGCC
TRN  10010101100011011
NAM  RL10A_RAT/4-212
ASQ  VSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQK-DKRFSGTVRL-KSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIP----RILGPGLNKAGKFPSLLT--HNENMVAKVDEVKS-TIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKN--WQNVRALYIKSTMGKP
DSQ  GTTTCACGCGACACCCTCTACGAGGCGGTGCGGGAAGTCCTGCACGGGAACCAGCGTAAGCGCCGCAAGTTTCTGGAGACGGTGGAGCTGCAGATCAGCCTGAAGAACTACGACCCTCAGAAG---GACAAACGCTTCTCGGGCACCGTCAGGCTT---AAGTCCACCCCTCGCCCCAAGTTCTCCGTGTGCGTCCTGGGGGACCAGCAGCACTGTGATGAAGCCAAGGCCGTGGATATCCCCCACATGGACATCGAGGCGCTCAAGAAGCTTAACAAGAACAAGAAGTTGGTCAAAAAGCTGGCCAAGAAGTATGATGCCTTTTTGGCCTCCGAGTCTCTGATCAAGCAAATCCCA------------CGTATCCTGGGCCCAGGCCTAAACAAGGCGGGCAAGTTCCCCTCCCTGCTGACA------CACAATGAAAACATGGTGGCCAAAGTGGATGAGGTGAAATCC---ACAATCAAGTTCCAGATGAAGAAGGTGCTGTGTCTGGCCGTTGCCGTCGGCCACGTGAAGATGACCGATGACGAGCTAGTCTACAACATCCACCTGGCTGTCAACTTCTTGGTGTCCTTACTCAAGAAAAAC------TGGCAGAACGTCCGGGCTCTGTACATCAAGAGCACCATGGGCAAGCCC
TRN  10010101100011000
//