EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00684 - DnaJ_CXXCXGXG)
FAM  PF00684
PID  DnaJ_CXXCXGXG
DES  DnaJ central domain (4 repeats)
IPR  IPR001305
ANO  22
ALN  89
AID  0.395137
APH  ((((((((((DNAJ_BORBU/135-215:0.78104,DNAJ_LEGPN/135-215:0.28467):0.08868,((DNAJ_CLOAB/137-221:0.27397,DNAJ_METMA/131-215:0.47357):0.15760,(DNAJ_BACSU/132-216:0.41403,DNAJ_STAAU/136-220:0.53753):0.13086):0.16654):0.05764,DNAJ_FRATU/127-206:0.50310):0.07939,((DNAJ_HAEDU/134-214:0.17164,DNAJ_HAEIN/134-214:0.19263):0.43997,(DNAJ_COXBU/133-212:0.49946,DNAJ_ECOLI/130-210:0.19826):0.06339):0.05547):0.18743,(YLW5_CAEEL/665-746:0.90489,(DNAJ_MYCLE/159-239:0.28537,DNAJ_STRCO/166-246:0.59042):0.40515):0.09580):0.24293,(DNAJ_MYCGE/151-236:1.11783,DNAJ_ERYRH/134-217:0.41828):0.15778):0.27711,SCJ1_YEAST/183-266:0.54227):0.20911,YNH7_YEAST/193-276:0.72865):0.20991,(DNJA1_HUMAN/121-207:0.26544,MAS5_YEAST/130-215:0.42385):0.11862):0.34786,DNJH_ARATH/136-222:0.14277,DNJH1_ALLPO/114-200:0.05379);
ATP  ((((((((((DNAJ_BORBU/135-215,DNAJ_LEGPN/135-215),((DNAJ_CLOAB/137-221,DNAJ_METMA/131-215),(DNAJ_BACSU/132-216,DNAJ_STAAU/136-220))),DNAJ_FRATU/127-206),((DNAJ_HAEDU/134-214,DNAJ_HAEIN/134-214),(DNAJ_COXBU/133-212,DNAJ_ECOLI/130-210))),(YLW5_CAEEL/665-746,(DNAJ_MYCLE/159-239,DNAJ_STRCO/166-246))),(DNAJ_MYCGE/151-236,DNAJ_ERYRH/134-217)),SCJ1_YEAST/183-266),YNH7_YEAST/193-276),(DNJA1_HUMAN/121-207,MAS5_YEAST/130-215)),DNJH_ARATH/136-222,DNJH1_ALLPO/114-200);
ATL  13.347
DNO  20
DLN  267
DID  0.461258
DPH  (MAS5_YEAST/130-215:0.23549,((DNJA1_HUMAN/121-207:0.25240,(DNJH1_ALLPO/114-200:0.06843,DNJH_ARATH/136-222:0.21386):0.26468):0.11024,(SCJ1_YEAST/183-266:0.37869,((((DNAJ_LEGPN/135-215:0.28090,DNAJ_BORBU/135-215:0.46176):0.05055,(DNAJ_FRATU/127-206:0.29743,((DNAJ_COXBU/133-212:0.37483,(DNAJ_ECOLI/130-210:0.13065,((DNAJ_STRCO/166-246:0.32076,DNAJ_MYCLE/159-239:0.31510):0.22003,DNAJ_METMA/131-215:0.44893):0.20125):0.09859):0.13824,DNAJ_HAEDU/134-214:0.31655):0.10360):0.08178):0.05550,(((DNAJ_STAAU/136-220:0.30471,DNAJ_BACSU/132-216:0.38534):0.10686,DNAJ_ERYRH/134-217:0.43398):0.01363,DNAJ_CLOAB/137-221:0.39519):0.06535):0.12635,DNAJ_MYCGE/151-236:0.55548):0.20956):0.10869):0.13169,YNH7_YEAST/193-276:0.53577);
DTP  (MAS5_YEAST/130-215,((DNJA1_HUMAN/121-207,(DNJH1_ALLPO/114-200,DNJH_ARATH/136-222)),(SCJ1_YEAST/183-266,((((DNAJ_LEGPN/135-215,DNAJ_BORBU/135-215),(DNAJ_FRATU/127-206,((DNAJ_COXBU/133-212,(DNAJ_ECOLI/130-210,((DNAJ_STRCO/166-246,DNAJ_MYCLE/159-239),DNAJ_METMA/131-215))),DNAJ_HAEDU/134-214))),(((DNAJ_STAAU/136-220,DNAJ_BACSU/132-216),DNAJ_ERYRH/134-217),DNAJ_CLOAB/137-221)),DNAJ_MYCGE/151-236))),YNH7_YEAST/193-276);
DTL  8.79283
RID  0.39546
RPH  (((((((((DNAJ_CLOAB/137-221:0.28242,DNAJ_METMA/131-215:0.46698):0.17423,(((DNAJ_HAEDU/134-214:0.56132,((DNAJ_COXBU/133-212:0.51458,DNAJ_ECOLI/130-210:0.17969):0.03410,(DNAJ_MYCLE/159-239:0.34879,DNAJ_STRCO/166-246:0.54548):0.60288):0.04229):0.10081,DNAJ_FRATU/127-206:0.50124):0.06749,(DNAJ_BORBU/135-215:0.79257,DNAJ_LEGPN/135-215:0.27355):0.08140):0.16255):0.07263,(DNAJ_BACSU/132-216:0.40050,DNAJ_STAAU/136-220:0.53569):0.09578):0.30290,DNAJ_ERYRH/134-217:0.56975):0.08944,DNAJ_MYCGE/151-236:1.02973):0.31161,SCJ1_YEAST/183-266:0.50202):0.23705,YNH7_YEAST/193-276:0.79281):0.17668,(DNJA1_HUMAN/121-207:0.25831,MAS5_YEAST/130-215:0.43365):0.11228):0.35482,DNJH_ARATH/136-222:0.14968,DNJH1_ALLPO/114-200:0.04724);
RTP  (((((((((DNAJ_CLOAB/137-221,DNAJ_METMA/131-215),(((DNAJ_HAEDU/134-214,((DNAJ_COXBU/133-212,DNAJ_ECOLI/130-210),(DNAJ_MYCLE/159-239,DNAJ_STRCO/166-246))),DNAJ_FRATU/127-206),(DNAJ_BORBU/135-215,DNAJ_LEGPN/135-215))),(DNAJ_BACSU/132-216,DNAJ_STAAU/136-220)),DNAJ_ERYRH/134-217),DNAJ_MYCGE/151-236),SCJ1_YEAST/183-266),YNH7_YEAST/193-276),(DNJA1_HUMAN/121-207,MAS5_YEAST/130-215)),DNJH_ARATH/136-222,DNJH1_ALLPO/114-200);
RTL  12.2213
LNK  DNAJ_BACSU/132-216:P17631:M84964
LNK  DNAJ_BORBU/135-215:P28616:M96847
LNK  DNAJ_CLOAB/137-221:P30725:X69050
LNK  DNAJ_COXBU/133-212:P42381:L36455
LNK  DNAJ_ECOLI/130-210:P08622:M12544
LNK  DNAJ_ERYRH/134-217:Q05646:L08110
LNK  DNAJ_FRATU/127-206:P48207:L43367
LNK  DNAJ_HAEDU/134-214:P48208:U25996
LNK  DNAJ_HAEIN/134-214:P43735:
LNK  DNAJ_LEGPN/135-215:P50025:U15010
LNK  DNAJ_METMA/131-215:P35515:X60265
LNK  DNAJ_MYCGE/151-236:P47265:U39681
LNK  DNAJ_MYCLE/159-239:Q02605:AL583925
LNK  DNAJ_STAAU/136-220:P45555:D30690
LNK  DNAJ_STRCO/166-246:P40170:L46700
LNK  DNJA1_HUMAN/121-207:P31689:D13388
LNK  DNJH1_ALLPO/114-200:Q03363:X69436
LNK  DNJH_ARATH/136-222:P42825:AL589883
LNK  MAS5_YEAST/130-215:P25491:S74758
LNK  SCJ1_YEAST/183-266:P25303:X58679
LNK  YLW5_CAEEL/665-746:P34408:
LNK  YNH7_YEAST/193-276:P53940:Z71353
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YNH7_YEAST/193-276
ASQ  GKTAKLGLNRTRICSVCDGHG---GLK.KCTCKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFVKNKDICQQCQGLGFIKERKI
DSQ  GGTAAGACTGCAAAGTTGGGTTTGAATAGGACAAGGATTTGCAGTGTTTGTGATGGGCACGGT---------GGTCTAAAG...AAATGCACTTGTAAAACATGCAAAGGGCAAGGTATTCAAACCCAAACTAGGCGTATGGGACCT---CTAGTACAAAGTTGGTCTCAAACTTGTGCAGATTGCGGGGGTGCCGGGGTTTTTGTCAAAAATAAAGATATTTGCCAACAGTGCCAAGGTCTTGGCTTCATTAAGGAGAGGAAGATT
TRN  10010101110011011
NAM  MAS5_YEAST/130-215
ASQ  GRTAKLALNKQILCKECEGRGGKKG-A.VKKCTSCNGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKI
DSQ  GGTAGGACAGCTAAGTTAGCCCTTAACAAACAGATCCTATGTAAAGAATGTGAAGGTCGTGGTGGTAAGAAAGGC---GCC...GTCAAGAAGTGTACCAGCTGTAATGGTCAAGGTATTAAATTTGTAACAAGACAAATGGGTCCA---ATGATCCAAAGATTCCAAACAGAGTGTGATGTCTGTCACGGTACTGGTGATATCATTGATCCTAAGGATCGTTGTAAATCTTGTAACGGTAAGAAAGTTGAAAACGAAAGGAAGATC
TRN  10010101110011010
NAM  DNJA1_HUMAN/121-207
ASQ  GATRKLALQKNVICDKCEGRGGKKG-A.VECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKI
DSQ  GGTGCAACAAGAAAACTGGCTCTGCAAAAGAATGTGATTTGTGACAAATGTGAAGGTAGAGGAGGTAAGAAAGGA---GCA...GTAGAGTGCTGTCCCAATTGCCGAGGTACTGGAATGCAAATAAGAATTCATCAGATAGGACCTGGAATGGTTCAGCAAATTCAGTCTGTGTGCATGGAGTGCCAGGGCCATGGGGAGCGGATCAGTCCTAAAGATAGATGTAAAAGCTGCAACGGAAGGAAGATAGTTCGAGAGAAAAAAATT
TRN  10010101100011011
NAM  DNJH1_ALLPO/114-200
ASQ  GTSKKLSLSRNVICSKCNGKGSKSG-A.SMRCASCQGSGMKVSIRQLGPGMIQQMQHPCNDCKGTGEMINDKDRCPLCKGEKVVQEKKV
DSQ  GGAACTTCTAAGAAACTCTCTTTGTCTAGAAATGTTATCTGCTCAAAGTGCAATGGCAAAGGATCAAAATCAGGT---GCT...TCAATGAGATGTGCATCTTGCCAAGGTTCTGGTATGAAAGTTTCTATTCGCCAGTTGGGTCCTGGAATGATTCAGCAGATGCAGCATCCTTGCAATGACTGTAAAGGCACAGGAGAAATGATAAATGATAAGGATAGGTGTCCATTGTGCAAAGGTGAAAAGGTCGTGCAAGAGAAGAAGGTT
TRN  10010101110011001
NAM  DNJH_ARATH/136-222
ASQ  GTTKKLSLSRKALCSKCNGKGSKSG-A.SMKCGGCQGSGMKISIRQFGPGMMQQVQHACNDCKGTGETINDRDRCPQCKGEKVVSEKKV
DSQ  GGAACAACAAAGAAGCTCTCACTTTCTAGGAAGGCTTTGTGCTCAAAGTGTAACGGCAAGGGTTCAAAGTCTGGA---GCT...TCAATGAAATGTGGTGGCTGTCAAGGTTCGGGAATGAAGATCTCGATCAGGCAGTTTGGACCTGGAATGATGCAGCAGGTGCAGCATGCTTGTAATGATTGCAAAGGCACAGGAGAGACCATCAATGATCGGGACAGGTGTCCACAATGCAAAGGAGAGAAGGTTGTCTCTGAGAAGAAGGTG
TRN  10010101110011001
NAM  SCJ1_YEAST/183-266
ASQ  GSSIEFTLNLNDECDACHGSGSADG-K.LAQCPDCQGRGVIIQVLRMG-IMTQQIQQMCGRCGGTGQIIK--NECKTCHGKKVTKKNKF
DSQ  GGGTCCTCGATAGAATTTACTTTAAACCTAAACGATGAATGTGATGCATGCCATGGTAGTGGCTCTGCAGATGGT---AAG...CTGGCCCAATGTCCCGATTGTCAAGGTCGTGGGGTTATAATACAAGTGCTGCGCATGGGT---ATTATGACGCAGCAGATTCAACAGATGTGTGGTAGGTGTGGTGGTACGGGACAAATTATCAAA------AATGAATGCAAAACATGTCACGGCAAAAAAGTTACCAAAAAGAACAAGTTC
TRN  10010101100011010
NAM  YLW5_CAEEL/665-746
ASQ  GATKNVSVNVVEDCLKCHGTQVEPGHK.KTSCPYCNGTGAVSQRLQG----GFFYQTTCNRCRGSGHYNK--NPCQECEGEGQTVQRRQ
NAM  DNAJ_STRCO/166-246
ASQ  GATVPLRMSSQAPCKACSGTGDKNG-T.PRVCPTCVGTG-QVARGSGG---GFSLTDPCPDCKGRGLIAE--DPCEVCKGSGRAKSSRT
DSQ  GGCGCGACCGTGCCGCTCCGGATGTCCTCGCAGGCGCCCTGCAAGGCCTGTTCGGGCACCGGCGACAAGAACGGC---ACG...CCGCGCGTGTGCCCGACCTGCGTCGGCACCGGC---CAGGTCGCCCGGGGCTCGGGCGGC---------GGCTTCTCCCTCACCGACCCGTGCCCGGACTGCAAGGGCCGCGGCCTGATCGCCGAG------GACCCCTGCGAGGTCTGCAAGGGCTCCGGACGCGCCAAGTCCTCGCGGACG
TRN  11011111101111111
NAM  DNAJ_MYCLE/159-239
ASQ  GVAMPLRLTSPAPCTNCHGSGARPGIS.PKVCSTCNGSG-VINRNQG----AFGFSEPCTECRGSGSIIE--HPCEECKGTGVTTRTRT
DSQ  GGTGTAGCGATGCCGCTGCGGCTGACCAGCCCAGCGCCGTGCACCAATTGCCATGGCAGCGGGGCACGTCCGGGAATCAGT...CCGAAAGTGTGTTCCACTTGCAACGGTTCCGGC---GTGATCAACCGCAATCAGGGT------------GCCTTTGGTTTCTCTGAGCCTTGTACCGAATGTCGGGGTAGCGGGTCGATCATCGAG------CACCCTTGCGAAGAGTGCAAAGGCACCGGGGTTACCACCCGGACCCGAACC
TRN  11011101101011011
NAM  DNAJ_STAAU/136-220
ASQ  GTTKEISIRKDVTCETCHGDGAKPGTS.KKTCSYCNGAG-HVAVEQNTILGRVRTEQVCPKCNGSGQEFE--EACPTCHGKGTENKTVK
DSQ  GGTACAACAAAAGAAATTTCAATCCGTAAAGATGTAACATGCGAAACATGTCATGGTGATGGTGCAAAGCCTGGAACAAGT...AAAAAGACTTGTAGTTACTGTAATGGCGCTGGT---CATGTAGCTGTAGAACAAAACACAATTTTAGGTAGAGTTCGTACTGAACAAGTTTGTCCTAAATGTAATGGAAGTGGTCAAGAATTTGAA------GAAGCTTGTCCAACATGTCACGGAAAAGGTACTGAAAATAAAACAGTTAAA
TRN  10110101110011000
NAM  DNAJ_BACSU/132-216
ASQ  GKETTIEIPREETCETCKGSGAKPGTN.PETCSHCGGSG-QLNVEQNTPFGKVVNRRVCHHCEGTGKIIK--NKCADCGGKGKIKKRKK
DSQ  GGTAAAGAAACAACCATCGAAATTCCCCGCGAGGAAACGTGCGAAACATGTAAAGGCTCAGGTGCGAAACCTGGAACAAAT...CCAGAAACATGCTCCCACTGCGGAGGCTCCGGC---CAGTTAAACGTGGAGCAAAATACACCGTTTGGAAAAGTCGTTAACAGACGGGTCTGCCACCACTGTGAAGGTACAGGCAAAATCATTAAA------AACAAATGTGCGGACTGCGGCGGCAAAGGAAAAATCAAAAAACGCAAGAAA
TRN  10110101110011000
NAM  DNAJ_METMA/131-215
ASQ  GVRKDIDIPRTERCSTCSGTGAKPGTS.PKRCPNCGGTG-QVRTTRSTLGMQFVSTTTCSACHGRGQVVE--SPCPTCSGAGRVRSRRK
DSQ  GGAGTGCGCAAGGACATAGATATTCCAAGGACAGAAAGGTGTTCTACCTGCTCAGGCACAGGAGCAAAGCCGGGCACAAGC...CCGAAGCGCTGCCCTAACTGCGGCGGCACGGGG---CAGGTCCGTACAACCCGCTCAACCCTGGGAATGCAGTTTGTAAGCACCACGACGTGCAGCGCCTGTCACGGCAGGGGTCAGGTAGTTGAA------TCTCCATGCCCCACATGTAGCGGCGCGGGCAGGGTCAGGAGCAGGAGAAAG
TRN  10010101100011001
NAM  DNAJ_CLOAB/137-221
ASQ  GVEKSINITRSENCETCGGTGAKKGTS.PKTCDKCGGTG-TIRVQRNTPLGSFVTQSSCDKCGGRGTIIS--DPCHECHGAGHVRKKRK
DSQ  GGCGTAGAGAAATCTATTAATATAACTAGAAGTGAAAACTGTGAAACATGCGGTGGTACAGGCGCAAAGAAAGGCACATCT...CCTAAAACTTGTGATAAGTGTGGAGGAACAGGT---ACTATAAGAGTTCAGAGGAATACTCCTCTCGGAAGCTTTGTTACTCAATCAAGTTGTGATAAATGCGGAGGACGCGGAACTATAATTTCT------GATCCATGTCATGAGTGTCATGGTGCAGGCCATGTTAGGAAGAAGAGAAAG
TRN  10010101110011001
NAM  DNAJ_LEGPN/135-215
ASQ  GKEVEITVPRHGTCTVCEGSGAKKGTS.PKTCETCQGMG-QVRIQQG----FFSIQQTCPTCHGEGKIIS--DPCASCHGQGRVRESKK
DSQ  GGAAAAGAAGTTGAAATTACCGTTCCAAGACATGGTACTTGTACTGTTTGTGAGGGATCGGGGGCTAAAAAAGGCACAAGC...CCAAAAACTTGTGAAACATGCCAGGGCATGGGG---CAAGTCAGAATTCAACAAGGT------------TTTTTTTCCATACAACAAACCTGCCCCACTTGTCATGGTGAGGGAAAAATAATTTCT------GATCCTTGTGCCAGTTGTCATGGTCAAGGAAGAGTTAGAGAAAGTAAAAAA
TRN  10010101110011011
NAM  DNAJ_ECOLI/130-210
ASQ  GVTKEIRIPTLEECDVCHGSGAKPGTQ.PQTCPTCHGSG-QVQMRQG----FFAVQQTCPHCQGRGTLIK--DPCNKCHGHGRVERSKT
DSQ  GGCGTGACCAAAGAGATCCGCATTCCGACTCTGGAAGAGTGTGACGTTTGCCACGGTAGCGGTGCAAAACCAGGTACACAG...CCGCAGACTTGTCCGACCTGTCATGGTTCTGGT---CAGGTGCAGATGCGCCAGGGA------------TTCTTCGCTGTACAGCAGACCTGTCCACACTGTCAGGGCCGCGGTACGCTGATCAAA------GATCCGTGCAACAAATGTCATGGTCATGGTCGTGTTGAGCGCAGCAAAACG
TRN  11011101101011011
NAM  DNAJ_COXBU/133-212
ASQ  GLSRTIKVPTWINCKTCNGSGAK-GSS.PATCPRCNGSG-QMRMQHG----FLQVQQTCSVCRGRGQVIK--DPCTDCHGQGRQQQTKT
DSQ  GGTCTTAGCCGAACGATTAAAGTACCGACCTGGATCAACTGCAAAACTTGCAATGGCAGCGGTGCGAAA---GGCAGCAGC...CCCGCTACTTGTCCGCGCTGTAATGGGTCGGGC---CAGATGCGAATGCAGCACGGT------------TTTCTGCAAGTTCAACAAACTTGCTCCGTTTGTCGGGGTAGGGGTCAGGTGATTAAA------GATCCCTGCACAGATTGTCACGGGCAAGGCCGCCAACAGCAAACAAAAACC
TRN  10010101100011011
NAM  DNAJ_FRATU/127-206
ASQ  GVEKEITIPRMESCDSCDGTGSKSRS-.KTTCHACHGQG-TIRRQQG----FFAFEQTCPVCNGTGYSIT--DPCDACYGNGKVKKQKT
DSQ  GGTGTTGAGAAAGAGATAACTATACCACGGATGGAGTCTTGTGATAGTTGTGATGGTACAGGCTCTAAATCCAGAAGC---...AAAACTACTTGTCATGCTTGTCATGGCCAAGGT---ACTATTCGTAGACAACAAGGT------------TTTTTTGCTTTTGAACAGACATGTCCAGTATGTAATGGTACTGGCTATAGTATTACT------GATCCTTGTGATGCTTGTTATGGTAATGGTAAAGTCAAGAAACAAAAGACT
TRN  10010101110011011
NAM  DNAJ_HAEIN/134-214
ASQ  GTTKDIQINTLAHCDSCGGSGAEKGSK.VETCPHCHGSG-RIRRQQG----FFVSESICPTCHGSGKKIE--KPCRNCHGEGRVHKKEN
NAM  DNAJ_HAEDU/134-214
ASQ  GCKKDIRLSTLAECDNCHGTGAEAGTK.VENCPHCHGAG-RIRRQQG----FFVTEAVCPSCHGTGKKIE--KPCHSCHGDGRVQKAKN
DSQ  GGCTGTAAAAAAGATATCCGCCTTTCTACCCTAGCAGAATGTGATAATTGTCACGGCACAGGAGCAGAAGCGGGAACTAAA...GTAGAAAATTGTCCGCATTGTCACGGTGCCGGT---CGTATTCGTCGTCAACAAGGC------------TTCTTTGTCACTGAAGCAGTCTGTCCAAGCTGTCATGGCACAGGTAAGAAAATTGAG------AAACCTTGCCATTCTTGCCACGGCGATGGTCGGGTACAAAAAGCGAAAAAT
TRN  11011101111011011
NAM  DNAJ_BORBU/135-215
ASQ  GYKNNINITRQMLCDSCLGKKSEKGTS.PSICNMCNGSG---RVVQG--GGFFRVTTTCSKCYGEGKIIS--NPCKSCKGKGSLTKQET
DSQ  GGGTACAAAAATAACATAAACATAACAAGACAAATGCTCTGTGATTCTTGTCTCGGGAAAAAATCCGAAAAAGGTACAAGT...CCTTCGATATGTAACATGTGTAACGGCAGCGGA---------AGAGTAGTGCAAGGC------GGAGGATTTTTCAGAGTTACAACAACATGTTCTAAATGTTACGGAGAAGGTAAAATAATATCA------AACCCTTGTAAATCCTGTAAAGGAAAAGGAAGTCTTACAAAGCAAGAAACC
TRN  10010101110011001
NAM  DNAJ_ERYRH/134-217
ASQ  GANKSVTLNVDEECTSCHGSGAHSKDD.IKTCSRCGGTG-QTVTQQRTPFGVFQSQATCPDCGGSGKTIT--KRCGECHGKGFNTKRV-
DSQ  GGTGCCAACAAATCCGTGACTTTAAATGTCGATGAAGAATGTACATCGTGTCATGGTTCGGGTGCACACAGCAAAGATGAT...ATCAAGACATGTTCACGTTGTGGTGGAACGGGT---CAAACGGTAACGCAACAACGTACACCTTTTGGAGTTTTCCAATCTCAAGCAACATGTCCGGACTGTGGTGGTTCAGGTAAAACAATTACA------AAACGCTGTGGTGAATGTCATGGTAAAGGATTTAATACAAAACGTGTC---
TRN  11111101111011000
NAM  DNAJ_MYCGE/151-236
ASQ  GCNKTIKYERKVSCHSCNGFGAEGGESgLDLCKDCNGNGFVIKNQRS-IFGTIQSQVLCSTCNGQGKQIK--VKCKTCRSNKYTVTNQI
DSQ  GGTTGCAACAAAACCATCAAATATGAAAGAAAAGTTTCATGTCATAGTTGTAATGGTTTTGGCGCTGAAGGCGGGGAAAGTggaTTGGATCTTTGTAAGGATTGTAATGGCAATGGTTTTGTTATTAAAAACCAACGTTCT---ATCTTTGGAACCATTCAATCCCAAGTCTTGTGTTCAACTTGCAATGGACAAGGAAAACAAATTAAA------GTTAAGTGCAAAACTTGTCGTTCTAACAAATACACTGTTACCAATCAAATT
TRN  10010101110011001
//