EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00681 - Plectin)
FAM  PF00681
PID  Plectin
DES  Plectin repeat
IPR  IPR001101
ANO  40
ALN  45
AID  0.32576
APH  ((((((((((MACF4_HUMAN/935-979:0.68685,BP1E_MOUSE/2438-2482:0.47667):0.02991,((Q8R167_MOUSE/187-231:0.71027,((DESP_HUMAN/2724-2768:0.19520,BP1E_MOUSE/2514-2558:0.58107):0.19937,PLEC1_RAT/4525-4569:0.22339):0.15169):0.30328,((BP1E_MOUSE/2203-2247:0.40892,(EPIPL_HUMAN/123-167:0.45012,EPIPL_HUMAN/1328-1372:0.40402):0.31143):0.27306,(((EPIPL_MOUSE/6464-6508:0.13483,DESP_HUMAN/2365-2409:0.21182):0.08295,(((EPIPL_HUMAN/367-411:0.51535,PLEC1_RAT/3937-3981:0.19355):0.10988,PLEC1_RAT/3271-3315:0.25978):0.17668,EPIPL_HUMAN/1979-2023:0.51470):0.10201):0.06408,EPIPL_HUMAN/1012-1056:0.37803):0.14807):0.23676):0.04667):0.03845,(MACF4_HUMAN/12-56:0.55742,DESP_HUMAN/2046-2090:0.52419):0.11944):0.05124,(((MACF4_HUMAN/241-285:0.50418,MACF4_HUMAN/725-769:0.63582):0.18181,BPAEB_HUMAN/1447-1491:0.57353):0.10891,((BPAEB_HUMAN/1523-1567:1.03299,(BPAEB_HUMAN/1333-1377:0.43959,MACF4_HUMAN/89-133:0.90363):0.09201):0.17346,MACF4_HUMAN/1121-1165:0.56570):0.04455):0.23665):0.07189,((((EPIPL_HUMAN/291-335:0.23747,(PLEC1_RAT/3195-3239:0.18622,(BP1E_MOUSE/2129-2173:0.38194,PLEC1_RAT/4104-4148:0.22159):0.15025):0.05334):0.02872,(PLEC1_RAT/3861-3905:0.15552,PLEC1_HUMAN/3523-3567:0.23049):0.05532):0.07503,EPIPL_HUMAN/1252-1296:0.39564):0.11349,EPIPL_HUMAN/47-91:0.33745):0.25305):0.08150,Q8R167_MOUSE/111-155:0.44866):0.07680,(DESP_HUMAN/2458-2500:0.64139,MACF4_HUMAN/801-845:0.68505):0.26497):0.68936,EPIPL_HUMAN/898-942:0.49995):0.14474,PLEC1_RAT/2829-2873:0.40628):0.09403,PLEC1_RAT/3488-3532:0.45558,EPIPL_HUMAN/578-622:0.19122);
ATP  ((((((((((MACF4_HUMAN/935-979,BP1E_MOUSE/2438-2482),((Q8R167_MOUSE/187-231,((DESP_HUMAN/2724-2768,BP1E_MOUSE/2514-2558),PLEC1_RAT/4525-4569)),((BP1E_MOUSE/2203-2247,(EPIPL_HUMAN/123-167,EPIPL_HUMAN/1328-1372)),(((EPIPL_MOUSE/6464-6508,DESP_HUMAN/2365-2409),(((EPIPL_HUMAN/367-411,PLEC1_RAT/3937-3981),PLEC1_RAT/3271-3315),EPIPL_HUMAN/1979-2023)),EPIPL_HUMAN/1012-1056)))),(MACF4_HUMAN/12-56,DESP_HUMAN/2046-2090)),(((MACF4_HUMAN/241-285,MACF4_HUMAN/725-769),BPAEB_HUMAN/1447-1491),((BPAEB_HUMAN/1523-1567,(BPAEB_HUMAN/1333-1377,MACF4_HUMAN/89-133)),MACF4_HUMAN/1121-1165))),((((EPIPL_HUMAN/291-335,(PLEC1_RAT/3195-3239,(BP1E_MOUSE/2129-2173,PLEC1_RAT/4104-4148))),(PLEC1_RAT/3861-3905,PLEC1_HUMAN/3523-3567)),EPIPL_HUMAN/1252-1296),EPIPL_HUMAN/47-91)),Q8R167_MOUSE/111-155),(DESP_HUMAN/2458-2500,MACF4_HUMAN/801-845)),EPIPL_HUMAN/898-942),PLEC1_RAT/2829-2873),PLEC1_RAT/3488-3532,EPIPL_HUMAN/578-622);
ATL  23.576
DNO  40
DLN  135
DID  0.438093
DPH  ((EPIPL_HUMAN/47-91:0.25926,(PLEC1_RAT/3861-3905:0.15407,(EPIPL_HUMAN/1252-1296:0.30141,(EPIPL_HUMAN/291-335:0.25820,PLEC1_HUMAN/3523-3567:0.15703):0.01313):0.04500):0.04008):0.11401,((Q8R167_MOUSE/111-155:0.38149,(((BP1E_MOUSE/2203-2247:0.44006,(Q8R167_MOUSE/187-231:0.47449,(PLEC1_RAT/4525-4569:0.24049,(DESP_HUMAN/2724-2768:0.21193,BP1E_MOUSE/2514-2558:0.39711):0.12836):0.13287):0.19309):0.00000,(((PLEC1_RAT/3937-3981:0.21450,EPIPL_HUMAN/1979-2023:0.34887):0.06070,(EPIPL_HUMAN/1012-1056:0.40707,((EPIPL_MOUSE/6464-6508:0.11338,DESP_HUMAN/2365-2409:0.38778):0.11713,PLEC1_RAT/3271-3315:0.26135):0.03600):0.08335):0.11364,(EPIPL_HUMAN/367-411:0.30590,(EPIPL_HUMAN/123-167:0.25271,EPIPL_HUMAN/1328-1372:0.22076):0.13267):0.09028):0.17726):0.16590,((BP1E_MOUSE/2438-2482:0.44683,(MACF4_HUMAN/89-133:0.60796,(BPAEB_HUMAN/1523-1567:0.56613,MACF4_HUMAN/1121-1165:0.32367):0.08548):0.02882):0.00264,((BPAEB_HUMAN/1447-1491:0.37344,MACF4_HUMAN/935-979:0.38860):0.19567,(((MACF4_HUMAN/241-285:0.39056,MACF4_HUMAN/725-769:0.50866):0.13930,((EPIPL_HUMAN/578-622:0.19813,(PLEC1_RAT/3488-3532:0.27014,PLEC1_RAT/2829-2873:0.34670):0.06869):0.20271,EPIPL_HUMAN/898-942:0.25560):0.52906):0.10016,((DESP_HUMAN/2458-2500:0.46700,MACF4_HUMAN/801-845:0.39723):0.15856,BPAEB_HUMAN/1333-1377:0.58370):0.15261):0.00000):0.07160):0.16719):0.00000):0.10873,((MACF4_HUMAN/12-56:0.34372,DESP_HUMAN/2046-2090:0.37714):0.05106,BP1E_MOUSE/2129-2173:0.42047):0.07322):0.14992,(PLEC1_RAT/4104-4148:0.20658,PLEC1_RAT/3195-3239:0.20042):0.00000);
DTP  ((EPIPL_HUMAN/47-91,(PLEC1_RAT/3861-3905,(EPIPL_HUMAN/1252-1296,(EPIPL_HUMAN/291-335,PLEC1_HUMAN/3523-3567)))),((Q8R167_MOUSE/111-155,(((BP1E_MOUSE/2203-2247,(Q8R167_MOUSE/187-231,(PLEC1_RAT/4525-4569,(DESP_HUMAN/2724-2768,BP1E_MOUSE/2514-2558)))),(((PLEC1_RAT/3937-3981,EPIPL_HUMAN/1979-2023),(EPIPL_HUMAN/1012-1056,((EPIPL_MOUSE/6464-6508,DESP_HUMAN/2365-2409),PLEC1_RAT/3271-3315))),(EPIPL_HUMAN/367-411,(EPIPL_HUMAN/123-167,EPIPL_HUMAN/1328-1372)))),((BP1E_MOUSE/2438-2482,(MACF4_HUMAN/89-133,(BPAEB_HUMAN/1523-1567,MACF4_HUMAN/1121-1165))),((BPAEB_HUMAN/1447-1491,MACF4_HUMAN/935-979),(((MACF4_HUMAN/241-285,MACF4_HUMAN/725-769),((EPIPL_HUMAN/578-622,(PLEC1_RAT/3488-3532,PLEC1_RAT/2829-2873)),EPIPL_HUMAN/898-942)),((DESP_HUMAN/2458-2500,MACF4_HUMAN/801-845),BPAEB_HUMAN/1333-1377)))))),((MACF4_HUMAN/12-56,DESP_HUMAN/2046-2090),BP1E_MOUSE/2129-2173)),(PLEC1_RAT/4104-4148,PLEC1_RAT/3195-3239));
DTL  33.9666
RID  0.32576
RPH  ((((((((((MACF4_HUMAN/935-979:0.68685,BP1E_MOUSE/2438-2482:0.47667):0.02991,((Q8R167_MOUSE/187-231:0.71027,((DESP_HUMAN/2724-2768:0.19520,BP1E_MOUSE/2514-2558:0.58107):0.19937,PLEC1_RAT/4525-4569:0.22339):0.15169):0.30328,((BP1E_MOUSE/2203-2247:0.40892,(EPIPL_HUMAN/123-167:0.45012,EPIPL_HUMAN/1328-1372:0.40402):0.31143):0.27306,(((EPIPL_MOUSE/6464-6508:0.13483,DESP_HUMAN/2365-2409:0.21182):0.08295,(((EPIPL_HUMAN/367-411:0.51535,PLEC1_RAT/3937-3981:0.19355):0.10988,PLEC1_RAT/3271-3315:0.25978):0.17668,EPIPL_HUMAN/1979-2023:0.51470):0.10201):0.06408,EPIPL_HUMAN/1012-1056:0.37803):0.14807):0.23676):0.04667):0.03845,(MACF4_HUMAN/12-56:0.55742,DESP_HUMAN/2046-2090:0.52419):0.11944):0.05124,(((MACF4_HUMAN/241-285:0.50418,MACF4_HUMAN/725-769:0.63582):0.18181,BPAEB_HUMAN/1447-1491:0.57353):0.10891,((BPAEB_HUMAN/1523-1567:1.03299,(BPAEB_HUMAN/1333-1377:0.43959,MACF4_HUMAN/89-133:0.90363):0.09201):0.17346,MACF4_HUMAN/1121-1165:0.56570):0.04455):0.23665):0.07189,((((EPIPL_HUMAN/291-335:0.23747,(PLEC1_RAT/3195-3239:0.18622,(BP1E_MOUSE/2129-2173:0.38194,PLEC1_RAT/4104-4148:0.22159):0.15025):0.05334):0.02872,(PLEC1_RAT/3861-3905:0.15552,PLEC1_HUMAN/3523-3567:0.23049):0.05532):0.07503,EPIPL_HUMAN/1252-1296:0.39564):0.11349,EPIPL_HUMAN/47-91:0.33745):0.25305):0.08150,Q8R167_MOUSE/111-155:0.44866):0.07680,(DESP_HUMAN/2458-2500:0.64139,MACF4_HUMAN/801-845:0.68505):0.26497):0.68936,EPIPL_HUMAN/898-942:0.49995):0.14474,PLEC1_RAT/2829-2873:0.40628):0.09403,PLEC1_RAT/3488-3532:0.45558,EPIPL_HUMAN/578-622:0.19122);
RTP  ((((((((((MACF4_HUMAN/935-979,BP1E_MOUSE/2438-2482),((Q8R167_MOUSE/187-231,((DESP_HUMAN/2724-2768,BP1E_MOUSE/2514-2558),PLEC1_RAT/4525-4569)),((BP1E_MOUSE/2203-2247,(EPIPL_HUMAN/123-167,EPIPL_HUMAN/1328-1372)),(((EPIPL_MOUSE/6464-6508,DESP_HUMAN/2365-2409),(((EPIPL_HUMAN/367-411,PLEC1_RAT/3937-3981),PLEC1_RAT/3271-3315),EPIPL_HUMAN/1979-2023)),EPIPL_HUMAN/1012-1056)))),(MACF4_HUMAN/12-56,DESP_HUMAN/2046-2090)),(((MACF4_HUMAN/241-285,MACF4_HUMAN/725-769),BPAEB_HUMAN/1447-1491),((BPAEB_HUMAN/1523-1567,(BPAEB_HUMAN/1333-1377,MACF4_HUMAN/89-133)),MACF4_HUMAN/1121-1165))),((((EPIPL_HUMAN/291-335,(PLEC1_RAT/3195-3239,(BP1E_MOUSE/2129-2173,PLEC1_RAT/4104-4148))),(PLEC1_RAT/3861-3905,PLEC1_HUMAN/3523-3567)),EPIPL_HUMAN/1252-1296),EPIPL_HUMAN/47-91)),Q8R167_MOUSE/111-155),(DESP_HUMAN/2458-2500,MACF4_HUMAN/801-845)),EPIPL_HUMAN/898-942),PLEC1_RAT/2829-2873),PLEC1_RAT/3488-3532,EPIPL_HUMAN/578-622);
RTL  23.576
LNK  BP1E_MOUSE/2129-2173:Q91ZU8:AF396877
LNK  BP1E_MOUSE/2203-2247:Q91ZU8:AF396877
LNK  BP1E_MOUSE/2438-2482:Q91ZU8:AF396877
LNK  BP1E_MOUSE/2514-2558:Q91ZU8:AF396877
LNK  BPAEB_HUMAN/1333-1377:Q8WXK8:AF400227
LNK  BPAEB_HUMAN/1447-1491:Q8WXK8:AF400227
LNK  BPAEB_HUMAN/1523-1567:Q8WXK8:AF400227
LNK  DESP_HUMAN/2046-2090:P15924:M77830
LNK  DESP_HUMAN/2365-2409:P15924:M77830
LNK  DESP_HUMAN/2458-2500:P15924:M77830
LNK  DESP_HUMAN/2724-2768:P15924:M77830
LNK  EPIPL_HUMAN/1012-1056:P58107:AB051895
LNK  EPIPL_HUMAN/123-167:P58107:AB051895
LNK  EPIPL_HUMAN/1252-1296:P58107:AB051895
LNK  EPIPL_HUMAN/1328-1372:P58107:AB051895
LNK  EPIPL_HUMAN/1979-2023:P58107:AB051895
LNK  EPIPL_HUMAN/291-335:P58107:AB051895
LNK  EPIPL_HUMAN/367-411:P58107:AB051895
LNK  EPIPL_HUMAN/47-91:P58107:AB051895
LNK  EPIPL_HUMAN/578-622:P58107:AB051895
LNK  EPIPL_HUMAN/898-942:P58107:AB051895
LNK  EPIPL_MOUSE/6464-6508:Q8R0W0:AY312170
LNK  MACF4_HUMAN/1121-1165:Q96PK2:AF317696
LNK  MACF4_HUMAN/12-56:Q96PK2:AF317696
LNK  MACF4_HUMAN/241-285:Q96PK2:AF317696
LNK  MACF4_HUMAN/725-769:Q96PK2:AF317696
LNK  MACF4_HUMAN/801-845:Q96PK2:AF317696
LNK  MACF4_HUMAN/89-133:Q96PK2:AF317696
LNK  MACF4_HUMAN/935-979:Q96PK2:AF317696
LNK  PLEC1_HUMAN/3523-3567:Q15149:Z54367
LNK  PLEC1_RAT/2829-2873:P30427:X59601
LNK  PLEC1_RAT/3195-3239:P30427:X59601
LNK  PLEC1_RAT/3271-3315:P30427:X59601
LNK  PLEC1_RAT/3488-3532:P30427:X59601
LNK  PLEC1_RAT/3861-3905:P30427:X59601
LNK  PLEC1_RAT/3937-3981:P30427:X59601
LNK  PLEC1_RAT/4104-4148:P30427:X59601
LNK  PLEC1_RAT/4525-4569:P30427:X59601
LNK  Q8R167_MOUSE/111-155:Q8R167:BC025156
LNK  Q8R167_MOUSE/187-231:Q8R167:BC025156
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PLEC1_HUMAN/3523-3567
ASQ  ALLLEAQAGTGFLVDPVRNQRLYVHEAVKAGVVGPELHEQLLSAE
DSQ  GCGCTCCTGCTGGAGGCGCAGGCGGGCACTGGCTTCCTGGTGGACCCCGTGCGGAACCAGCGCCTGTATGTTCACGAAGCCGTGAAGGCGGGCGTGGTGGGCCCCGAGCTTCACGAGCAGCTGCTGTCTGCCGAG
TRN  11011111101111111
NAM  PLEC1_RAT/3861-3905
ASQ  RLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAE
DSQ  CGCTTGCTGCTGGAAGCACAGGCAGCCACAGGCTTTCTGCTGGACCCAGTGAAAGGCGAGAGGCTGACTGTGGACGAGGCCGTGCGGAAGGGTCTGGTAGGCCCCGAGCTGCACGATCGGCTCCTCTCTGCCGAG
TRN  10010101100011011
NAM  EPIPL_HUMAN/291-335
ASQ  LPLLEAQAATHTLVDPITGQRLWVDEAVRAGLVSPELHEQLLVAE
DSQ  CTGCCACTCCTAGAGGCCCAGGCTGCCACCCACACCCTGGTGGACCCCATCACAGGCCAGCGGCTGTGGGTAGACGAGGCAGTCAGGGCGGGCCTGGTCAGCCCAGAGCTCCATGAGCAGCTCCTGGTGGCTGAG
TRN  10010101100011011
NAM  PLEC1_RAT/3195-3239
ASQ  VALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPEMHEKLLSAE
DSQ  GTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCACATCATTGACCCTGCCACGAGTGCCAGGCTGACTGTGGATGAGGCAGTGCGTGCTGGCCTGGTGGGTCCTGAGATGCACGAGAAGCTCTTGTCAGCTGAG
TRN  10010101100011001
NAM  PLEC1_RAT/4104-4148
ASQ  FELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAE
DSQ  TTCGAGCTCCTGGAAGCGCAGGCAGCCACCGGCTACGTCATTGACCCTATCAAGGGGCTCAAGCTGACTGTGGAAGAGGCCGTGCGCATGGGTATCGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCTGCTGAG
TRN  11011111101111111
NAM  EPIPL_HUMAN/1252-1296
ASQ  QRLLEAQVASGFLVDPLNNQRLSVEDAVKVGLVGRELSEQLGQAE
DSQ  CAGAGGCTGCTGGAAGCCCAGGTGGCATCTGGCTTCCTTGTTGACCCCCTGAACAACCAGAGACTGTCAGTGGAGGACGCGGTTAAGGTCGGCCTGGTGGGCAGGGAGCTGAGTGAGCAGCTCGGGCAGGCCGAG
TRN  10010101100011001
NAM  EPIPL_HUMAN/47-91
ASQ  QALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAE
DSQ  CAGGCTCTGCTAGAGGCCCAGGCAGCCACTGGGGGCCTGGTGGACCTCGCCCGGGGCCAGCTGCTCCCTGTGTCCAAGGCCCTGCAGCAGGGTCTGGTGGGGCTGGAGCTGAAGGAGAAGCTGCTGGCCGCTGAG
TRN  11011111101111111
NAM  BP1E_MOUSE/2129-2173
ASQ  LAFLEAQAATGFIIDPVSGQTYCVEDAVLHGIVDPEFRSRLLEAE
DSQ  CTAGCCTTTTTAGAAGCTCAGGCTGCAACAGGTTTTATAATTGATCCGGTTTCTGGTCAGACTTACTGTGTTGAAGATGCAGTTCTTCATGGCATCGTTGATCCTGAGTTCAGGAGCAGGCTCCTGGAGGCAGAG
TRN  10010101100011010
NAM  Q8R167_MOUSE/111-155
ASQ  QKLLEAQAATGGIVDLLSRERYSVHKAVERGLIENTSTQRLLNAQ
DSQ  CAGAAGCTGTTGGAGGCCCAGGCAGCCACGGGAGGCATTGTTGACCTTCTTAGCCGAGAACGGTACTCCGTACACAAGGCGGTGGAGCGGGGACTCATTGAGAACACCTCCACTCAACGGCTGCTCAATGCTCAG
TRN  11011111101111111
NAM  DESP_HUMAN/2046-2090
ASQ  VMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAE
DSQ  GTCATGCTTCTGGAGGCCCAGGCAGCTACAGGTGGTATAATTGATCCCCATCGGAATGAGAAGCTGACTGTCGACAGTGCCATAGCTCGGGACCTCATTGACTTCGATGACCGTCAGCAGATATATGCAGCAGAA
TRN  10010111100111011
NAM  MACF4_HUMAN/1121-1165
ASQ  LKVLEAQANTGGIIDTATGKRLTLASALEEKLVDENMVRIIASHQ
DSQ  CTGAAGGTTCTAGAAGCCCAGGCAAATACTGGTGGAATCATAGATACTGCTACTGGAAAAAGACTGACATTGGCATCAGCTTTGGAAGAGAAACTGGTGGATGAAAACATGGTCAGAATTATTGCATCTCATCAG
TRN  10010101100011001
NAM  BP1E_MOUSE/2438-2482
ASQ  LRCLEAQICTGGIIDPLTGKKYRVAEALHRGLVDEGFAQQLRQCE
DSQ  CTCAGATGCCTTGAAGCCCAAATCTGTACAGGAGGGATCATCGATCCCCTAACTGGGAAAAAGTACAGGGTGGCCGAGGCTTTGCATAGAGGGCTGGTGGACGAGGGCTTCGCCCAGCAGCTACGCCAGTGTGAA
TRN  10010101100011011
NAM  EPIPL_HUMAN/1979-2023
ASQ  LRLLEVQVATGGVIDPQHHHRLPLETAYRRGCLHKDIYALISDQK
DSQ  CTGAGGCTGCTGGAGGTGCAGGTGGCCACGGGGGGTGTCATCGACCCACAGCACCACCACCGGCTCCCACTGGAAACAGCCTACAGACGGGGCTGTCTGCACAAGGACATCTATGCGCTCATTTCCGACCAGAAG
TRN  10010101100011011
NAM  EPIPL_HUMAN/1012-1056
ASQ  ARLLEAQVATGGIIDPTSHHHLPMPVAIQRGYVDQEMETALSSSS
DSQ  GCCCGCCTCCTGGAGGCTCAAGTGGCCACAGGAGGGATCATTGACCCCACCAGCCACCACCACCTCCCCATGCCAGTGGCCATTCAGCGTGGCTATGTTGACCAGGAGATGGAGACAGCCTTGTCCAGCTCCTCC
TRN  11011111101111111
NAM  DESP_HUMAN/2365-2409
ASQ  IRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPS
DSQ  ATTCGCTTATTAGAAGCACAGATCGCAACCGGGGGGATCATTGACCCAAAGGAGAGCCATCGTTTACCAGTTGACATAGCATATAAGAGGGGCTATTTCAATGAGGAACTCAGTGAGATTCTCTCAGATCCAAGT
TRN  10010101110011000
NAM  EPIPL_MOUSE/6464-6508
ASQ  IRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDQEMNSILADPG
DSQ  ATTCGACTGCTGGAAGCCCAGATTGCCACAGGTGGCGTCATCGATCCTGTGCACAGCCACCGTGTGCCCGTGGACGTGGCCTACCAGCGTGGCTACTTTGATCAAGAGATGAACAGCATTTTGGCAGACCCTGGT
TRN  11011111101111111
NAM  EPIPL_HUMAN/367-411
ASQ  LRLLDAQLATGGLVCPARRLRLPLEAALRCGCLDEDTQRQLSQAG
DSQ  CTGCGGCTCTTGGATGCCCAGCTGGCCACAGGCGGGCTGGTCTGTCCAGCACGCAGGCTCCGGCTGCCCCTGGAGGCCGCCCTGCGCTGCGGCTGCCTGGATGAAGACACTCAGCGGCAGCTCTCGCAGGCTGGC
TRN  10010101100011011
NAM  PLEC1_RAT/3937-3981
ASQ  LRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPS
DSQ  CTGAGGCTGCTGGATGCTCAGCTAGCCACAGGAGGCATTGTGGACCCCCGCCTGGGTTTCCACCTCCCCCTGGAGGTGGCTTACCAACGAGGCTACCTCAATAAGGACACGCATGACCAGTTGTCAGAGCCCAGT
TRN  10010101100011001
NAM  PLEC1_RAT/3271-3315
ASQ  LRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPR
DSQ  CTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCATTGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGA
TRN  10010101100011000
NAM  EPIPL_HUMAN/1328-1372
ASQ  LPLLQVQLATGGVVDPVHGVHLPQAAACRLGLLDTQTSQVLTAVD
DSQ  TTGCCCCTCCTGCAGGTGCAGCTGGCCACAGGGGGTGTGGTGGACCCTGTCCACGGGGTGCACCTGCCCCAGGCGGCAGCCTGCAGACTCGGCCTTCTGGACACACAGACGAGCCAGGTGCTGACTGCAGTTGAC
TRN  10010101100011011
NAM  EPIPL_HUMAN/123-167
ASQ  QSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELE
DSQ  CAGAGCTGGCTGGAGGTCCAACTGGCCACTGGGGGCCTGGTGGACCCCGCCCAGGGAGTGCTCGTGGCCCCTGAGCCAGCCTGCCACCAGGGCCTCCTGGACCGGGAGACATGGCACAAGCTGTCAGAGCTTGAG
TRN  11011111101111101
NAM  BP1E_MOUSE/2203-2247
ASQ  KHILEAQIASGGVIDPVRGVRVPPEMAVQQGLLNNAVLQFLHEPS
DSQ  AAACATATCTTGGAGGCACAAATTGCCAGTGGGGGCGTCATTGACCCTGTGAGAGGCGTCCGTGTCCCTCCAGAAATGGCTGTGCAGCAGGGCTTGCTGAACAACGCCGTCCTACAGTTCCTGCATGAACCGTCC
TRN  10010101100011011
NAM  MACF4_HUMAN/935-979
ASQ  VRLLTKQVVDGGIIHHISGMRLSVDNAFRHGLIGEDLAEKLKRVE
DSQ  GTTCGTTTGTTGACTAAGCAAGTGGTAGATGGAGGTATCATTCACCATATATCTGGGATGAGACTTTCTGTTGATAATGCCTTCAGACATGGCTTAATTGGTGAAGATTTAGCCGAGAAACTCAAAAGAGTTGAG
TRN  10010101110011010
NAM  BPAEB_HUMAN/1447-1491
ASQ  FRLLSAQLLSGGLINSNSGQRMTVEEAVREGVIDRDTASSILTYQ
DSQ  TTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTCAGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAG
TRN  10010101100011010
NAM  BP1E_MOUSE/2514-2558
ASQ  MRCLEFQYLTGGLIEPKVFSRLTIEEALHVGIIDVLIATRLKDQK
DSQ  ATGCGGTGCCTGGAATTTCAGTACCTGACAGGGGGCCTGATAGAGCCGAAGGTTTTCTCGAGGCTGACCATAGAAGAGGCCCTTCACGTCGGTATCATTGATGTCCTCATCGCCACCAGACTCAAAGATCAAAAG
TRN  10010101100011011
NAM  PLEC1_RAT/4525-4569
ASQ  QRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVS
DSQ  CAGCGTTTCCTCGAGGTGCAGTACCTGACGGGTGGTCTGATTGAGCCTGACACACCTGGCCGTGTGTCTCTTGATGAAGCCTTGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGT
TRN  11011111101111111
NAM  DESP_HUMAN/2724-2768
ASQ  QRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTS
DSQ  CAGCGCTTCCTGGAGTTCCAGTACCTCACGGGAGGTCTTGTTGACCCGGAAGTGCATGGGAGGATAAGCACCGAAGAAGCCATCCGGAAGGGGTTCATAGATGGCCGCGCCGCACAGAGGCTGCAAGACACCAGC
TRN  10010101100011011
NAM  Q8R167_MOUSE/187-231
ASQ  LPHLLVQHLTGGLIDPKRTGRIPVPQAVLCGMISEDLGQLLQDES
DSQ  CTTCCCCACCTGCTGGTACAGCACCTGACTGGGGGCCTCATCGACCCCAAGAGGACGGGACGCATCCCCGTCCCTCAGGCTGTGCTCTGCGGGATGATCAGCGAAGACCTGGGCCAGCTCCTGCAAGATGAATCC
TRN  10010101100011011
NAM  MACF4_HUMAN/725-769
ASQ  LNVLSAQLLDGGIFHEQTGQKLLLNEAISRGIVPSHTAVKLMEKL
DSQ  TTAAATGTATTATCTGCACAGTTACTAGATGGTGGTATCTTTCATGAACAAACAGGTCAAAAGCTCTTACTAAATGAAGCAATATCCCGAGGCATTGTGCCAAGTCACACTGCCGTGAAGCTTATGGAGAAGCTG
TRN  10010111100111010
NAM  MACF4_HUMAN/241-285
ASQ  CAILIRQLQTGGIIDTVTGQRLTIDEAVSNDLVAAKIALVILESL
DSQ  TGTGCTATCCTCATAAGGCAGCTTCAGACAGGAGGCATCATAGACACTGTCACGGGGCAAAGGCTAACAATAGATGAAGCAGTGAGCAATGATCTAGTAGCTGCTAAGATCGCCCTTGTGATTCTGGAGTCCCTC
TRN  10010101100011011
NAM  MACF4_HUMAN/12-56
ASQ  LVLLESQVIMSGLIAPETGENLSLEEGIARNLINPQMYQQLRELQ
DSQ  CTAGTGCTTCTGGAATCTCAGGTTATCATGTCTGGCCTCATTGCCCCTGAGACGGGTGAAAACCTCTCTTTGGAGGAGGGCATAGCCAGAAACCTCATTAATCCCCAGATGTACCAGCAGCTCCGGGAGCTACAG
TRN  10010101100011011
NAM  MACF4_HUMAN/89-133
ASQ  LKILEAHLATGGFSLSPSENCINLEEAFHQGLISAWLHSVLESYL
DSQ  CTGAAAATCTTAGAAGCTCACCTGGCAACTGGAGGTTTCAGTCTTTCCCCTAGTGAGAACTGTATTAACCTGGAAGAGGCTTTTCATCAAGGCCTCATTTCTGCATGGCTTCATTCAGTATTAGAGTCTTATCTT
TRN  11011101101011000
NAM  BPAEB_HUMAN/1333-1377
ASQ  IKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQ
DSQ  ATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTGACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAA
TRN  10010101100011000
NAM  MACF4_HUMAN/801-845
ASQ  HNVLMADKAISGVLDPRTQTLCSVKDAVTVGLLDKETATRILERQ
DSQ  CATAATGTCCTCATGGCAGACAAAGCTATAAGTGGTGTCTTAGACCCCCGTACCCAGACACTGTGCTCTGTAAAGGATGCAGTTACAGTTGGACTTCTTGACAAGGAAACAGCCACCAGAATTTTAGAGAGGCAG
TRN  10010101100011010
NAM  DESP_HUMAN/2458-2500
ASQ  KNTLRKRRVV--IVDPETNKEMSVQEAYKKGLIDYETFKELCEQE
DSQ  AAGAATACCCTCAGGAAGCGTAGAGTGGTC------ATAGTTGACCCAGAAACCAATAAAGAAATGTCTGTTCAGGAGGCCTACAAGAAGGGCCTAATTGATTATGAAACCTTCAAAGAACTGTGTGAGCAGGAA
TRN  10010101100011011
NAM  EPIPL_HUMAN/898-942
ASQ  RRYLCGLGAVGGVRLLPSGQRLSLYQAMRQKLLGPRVALALLEAQ
DSQ  CGCAGGTACCTGTGCGGCCTGGGAGCTGTGGGCGGTGTGCGGCTGCTGCCCTCTGGCCAGCGGCTCAGCCTCTACCAGGCCATGAGGCAGAAGCTGCTGGGGCCCAGGGTGGCCCTGGCCCTGCTGGAGGCCCAG
TRN  10010101100011011
NAM  EPIPL_HUMAN/578-622
ASQ  QRYLQGTGCIAGLLLPGSQERLSIYEARCKGLLRPGTALILLEAQ
DSQ  CAGAGGTACCTGCAGGGTACGGGCTGCATTGCTGGCCTGCTGCTCCCTGGCTCCCAGGAACGCCTGAGCATCTATGAGGCCCGATGCAAGGGGCTCCTCCGGCCCGGCACTGCCCTCATCCTTCTGGAGGCACAA
TRN  10010101100011011
NAM  PLEC1_RAT/2829-2873
ASQ  RHYLKGGSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQ
DSQ  CGCCACTACCTGAAGGGCGGCAGCAGCATCGCAGGATTGCTCCTGAAGCCCACCAATGAGAAACTGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCTGGAACAGCCCTTATCTTACTTGAGGCCCAG
TRN  11011101101011010
NAM  PLEC1_RAT/3488-3532
ASQ  RTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRASTATLLLEAQ
DSQ  CGGACACTGCTGCAAGGCAGCGGCTGCCTGGCTGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGCCGGGGCCTCCTCAGAGCCAGCACAGCCACACTCCTGCTGGAGGCCCAG
TRN  10010101100011011
NAM  BPAEB_HUMAN/1523-1567
ASQ  LLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGR
DSQ  CTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGACTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTGAATGGCAGA
TRN  10010101100011001
//