EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00666 - Cathelicidins)
FAM  PF00666
PID  Cathelicidins
DES  Cathelicidin
IPR  IPR001894
ANO  8
ALN  68
AID  0.594064
APH  (((BCTN5_BOVIN/31-97:0.14823,((BCTN1_BOVIN/31-97:0.08152,ICTL_PIG/1-67:0.16828):0.01678,SC51_SHEEP/31-98:0.15577):0.01906):0.06141,(CRAMP_MOUSE/29-95:0.31071,CAP18_RABIT/31-97:0.30279):0.02551):0.11971,P15A_RABIT/25-89:1.34158,FAL39_HUMAN/32-98:0.13629);
ATP  (((BCTN5_BOVIN/31-97,((BCTN1_BOVIN/31-97,ICTL_PIG/1-67),SC51_SHEEP/31-98)),(CRAMP_MOUSE/29-95,CAP18_RABIT/31-97)),P15A_RABIT/25-89,FAL39_HUMAN/32-98);
ATL  2.88139
DNO  7
DLN  204
DID  0.670949
DPH  ((((FAL39_HUMAN/32-98:0.14033,CAP18_RABIT/31-97:0.15511):0.02470,CRAMP_MOUSE/29-95:0.21798):0.08510,(P15A_RABIT/25-89:0.80999,BCTN5_BOVIN/31-97:0.02600):0.06569):0.01504,BCTN1_BOVIN/31-97:0.10926,SC51_SHEEP/31-98:0.06632);
DTP  ((((FAL39_HUMAN/32-98,CAP18_RABIT/31-97),CRAMP_MOUSE/29-95),(P15A_RABIT/25-89,BCTN5_BOVIN/31-97)),BCTN1_BOVIN/31-97,SC51_SHEEP/31-98);
DTL  1.7085
RID  0.574421
RPH  (CAP18_RABIT/31-97:0.28464,(CRAMP_MOUSE/29-95:0.32410,((BCTN1_BOVIN/31-97:0.10537,SC51_SHEEP/31-98:0.15217):0.01853,BCTN5_BOVIN/31-97:0.14661):0.07011):0.03715,(P15A_RABIT/25-89:1.39188,FAL39_HUMAN/32-98:0.09308):0.13721);
RTP  (CAP18_RABIT/31-97,(CRAMP_MOUSE/29-95,((BCTN1_BOVIN/31-97,SC51_SHEEP/31-98),BCTN5_BOVIN/31-97)),(P15A_RABIT/25-89,FAL39_HUMAN/32-98));
RTL  2.72187
LNK  BCTN1_BOVIN/31-97:P22226:L08834
LNK  BCTN5_BOVIN/31-97:P19660:L02650
LNK  CAP18_RABIT/31-97:P25230:M73998
LNK  CRAMP_MOUSE/29-95:P51437:U43409
LNK  FAL39_HUMAN/32-98:P49913:Z38026
LNK  ICTL_PIG/1-67:P15175:
LNK  P15A_RABIT/25-89:P26202:L07588
LNK  SC51_SHEEP/31-98:P49928:X92757
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SC51_SHEEP/31-98
ASQ  VLSYREAVLRAADQLNEKSSEANLYRLLELDPPpKQDDENSNIPKPVSFRVKETVCPRTSQQPAEQCD
DSQ  GTCCTCAGCTACAGGGAGGCTGTGCTTCGTGCTGCGGATCAGCTCAATGAGAAGTCCTCAGAAGCTAATCTCTACCGCCTCCTGGAGCTAGACCCGCCTcccAAGCAGGATGACGAGAACTCAAACATCCCGAAGCCTGTGAGCTTCAGGGTGAAGGAGACCGTGTGCCCCAGGACGAGCCAGCAGCCCGCGGAGCAGTGTGAC
TRN  10010101100011001
NAM  BCTN5_BOVIN/31-97
ASQ  ALSYREAVLRAVDQFNERSSEANLYRLLELDPT.PNDDLDPGTRKPVSFRVKETDCPRTSQQPLEQCD
DSQ  GCCCTCAGCTACAGGGAGGCCGTGCTTCGTGCCGTGGATCAGTTCAATGAGCGGTCCTCAGAAGCTAATCTCTACCGCCTCCTGGAGCTAGACCCTACA...CCCAATGATGACTTGGACCCAGGCACCAGAAAGCCTGTGAGCTTCAGGGTGAAGGAGACCGATTGCCCCAGGACAAGCCAGCAGCCCCTGGAGCAGTGTGAC
TRN  10010101100011001
NAM  ICTL_PIG/1-67
ASQ  QLRYREAVLRAVDRLNEQSSEANLYRLLELDQP.PKADEDPGTPKPVSFTVKETVCPRPTRQPPELCD
NAM  BCTN1_BOVIN/31-97
ASQ  ALSYREAVLRAVDQLNEQSSEPNIYRLLELDQP.PQDDEDPDSPKRVSFRVKETVCSRTTQQPPEQCD
DSQ  GCCCTCAGCTACAGGGAGGCCGTGCTTCGTGCTGTGGATCAGCTCAATGAGCAATCCTCAGAACCTAACATTTACCGTCTTCTCGAGCTGGACCAGCCT...CCTCAGGATGATGAAGACCCAGACAGCCCGAAGCGGGTGAGCTTCAGGGTGAAGGAGACCGTGTGCTCCAGGACCACCCAGCAGCCCCCCGAGCAGTGTGAC
TRN  10010101100011001
NAM  FAL39_HUMAN/32-98
ASQ  VLSYKEAVLRAIDGINQRSSDANLYRLLDLDPR.PTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCD
DSQ  GTCCTCAGCTACAAGGAAGCTGTCCTTCGTGCTATAGATGGCATCAACCAGCGGTCCTCGGATGCTAACCTCTACCGCCTCCTGGACCTGGACCCCAGG...CCCACGATGGATGGGGACCCAGACACGCCAAAGCCTGTGAGCTTCACAGTGAAGGAGACAGTGTGCCCCAGGACGACACAGCAGTCACCAGAGGATTGTGAC
TRN  10010101100011001
NAM  CAP18_RABIT/31-97
ASQ  DLTYREAVLRAVDAFNQQSSEANLYRLLSMDPQ.QLEDAKPYTPQPVSFTVKETECPRTTWKLPEQCD
DSQ  GACCTCACCTACCGGGAGGCTGTGCTCCGCGCTGTGGATGCCTTCAACCAGCAGTCCTCAGAGGCCAACCTCTACCGCCTCCTGAGCATGGACCCCCAG...CAGCTGGAGGATGCGAAGCCATACACCCCGCAGCCTGTGAGCTTTACGGTGAAGGAGACGGAGTGCCCCCGGACAACATGGAAGCTACCAGAGCAGTGTGAC
TRN  11011111101111101
NAM  CRAMP_MOUSE/29-95
ASQ  TPSYRDAVLRAVDDFNQQSLDTNLYRLLDLDPE.PQGDEDPDTPKSVRFRVKETVCGKAERQLPEQCA
DSQ  ACCCCCAGCTACAGGGATGCTGTGCTCCGAGCTGTGGATGACTTCAACCAGCAGTCCCTAGACACCAATCTCTACCGTCTCCTGGACCTGGATCCTGAG...CCCCAAGGGGACGAGGATCCAGATACTCCCAAGTCTGTGAGGTTCCGAGTGAAGGAGACTGTATGTGGCAAGGCAGAGCGGCAGCTACCTGAGCAATGTGCC
TRN  10010101100011011
NAM  P15A_RABIT/25-89
ASQ  RLRYEEVVAQALQFYNEGQQGQPLFRLLEATPP.PSLNSKS--RIPLNFRIKETVCIFTLDRQPGNCA
DSQ  CGTCTGAGATATGAGGAGGTTGTGGCCCAGGCCTTGCAGTTCTACAATGAGGGGCAACAGGGCCAGCCCCTCTTCCGCCTGCTGGAAGCCACCCCACCA...CCTAGTCTGAACTCCAAATCC------AGGATCCCACTCAACTTCAGGATTAAAGAGACGGTGTGCATTTTCACTCTGGACAGACAGCCTGGAAACTGTGCC
TRN  10010101100011011
//