EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00645 - zf-PARP)
FAM  PF00645
PID  zf-PARP
DES  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region
IPR  IPR001510
ANO  14
ALN  94
AID  0.440144
APH  (PARP1_XENLA/1-78:0.15538,PARP1_CHICK/9-91:0.05882,(((DNL3_HUMAN/6-98:0.81509,((PARP_DROME/111-200:0.24662,PARP_SARPE/114-203:0.06639):0.44247,((PARP1_BOVIN/115-205:0.17885,(PARP1_MOUSE/112-202:0.05642,PARP1_HUMAN/112-202:0.06394):0.06812):0.14979,PARP1_CHICK/113-203:0.04331):0.42409):0.57358):0.17677,(PARP_DROME/7-89:0.40628,PARP_SARPE/7-89:0.19724):0.18693):0.37416,(PARP1_BOVIN/8-92:0.14288,(PARP1_MOUSE/8-92:0.02401,PARP1_HUMAN/8-92:0.00000):0.02764):0.24679):0.04129);
ATP  (PARP1_XENLA/1-78,PARP1_CHICK/9-91,(((DNL3_HUMAN/6-98,((PARP_DROME/111-200,PARP_SARPE/114-203),((PARP1_BOVIN/115-205,(PARP1_MOUSE/112-202,PARP1_HUMAN/112-202)),PARP1_CHICK/113-203))),(PARP_DROME/7-89,PARP_SARPE/7-89)),(PARP1_BOVIN/8-92,(PARP1_MOUSE/8-92,PARP1_HUMAN/8-92))));
ATL  5.16686
DNO  14
DLN  282
DID  0.513234
DPH  ((((((((PARP1_BOVIN/8-92:0.09645,PARP1_HUMAN/8-92:0.03397):0.02112,PARP1_MOUSE/8-92:0.03584):0.15216,PARP1_CHICK/9-91:0.09331):0.06929,PARP1_XENLA/1-78:0.12630):0.22788,(PARP_DROME/7-89:0.23938,PARP_SARPE/7-89:0.32837):0.23747):0.13574,DNL3_HUMAN/6-98:0.46409):0.29359,((PARP1_BOVIN/115-205:0.13868,(PARP1_MOUSE/112-202:0.05526,PARP1_HUMAN/112-202:0.07082):0.02416):0.23313,PARP1_CHICK/113-203:0.02389):0.29448):0.38001,PARP_DROME/111-200:0.16874,PARP_SARPE/114-203:0.17909);
DTP  ((((((((PARP1_BOVIN/8-92,PARP1_HUMAN/8-92),PARP1_MOUSE/8-92),PARP1_CHICK/9-91),PARP1_XENLA/1-78),(PARP_DROME/7-89,PARP_SARPE/7-89)),DNL3_HUMAN/6-98),((PARP1_BOVIN/115-205,(PARP1_MOUSE/112-202,PARP1_HUMAN/112-202)),PARP1_CHICK/113-203)),PARP_DROME/111-200,PARP_SARPE/114-203);
DTL  4.12323
RID  0.440144
RPH  (PARP1_XENLA/1-78:0.15538,PARP1_CHICK/9-91:0.05882,(((DNL3_HUMAN/6-98:0.81509,((PARP_DROME/111-200:0.24662,PARP_SARPE/114-203:0.06639):0.44247,((PARP1_BOVIN/115-205:0.17885,(PARP1_MOUSE/112-202:0.05642,PARP1_HUMAN/112-202:0.06394):0.06812):0.14979,PARP1_CHICK/113-203:0.04331):0.42409):0.57358):0.17677,(PARP_DROME/7-89:0.40628,PARP_SARPE/7-89:0.19724):0.18693):0.37416,(PARP1_BOVIN/8-92:0.14288,(PARP1_MOUSE/8-92:0.02401,PARP1_HUMAN/8-92:0.00000):0.02764):0.24679):0.04129);
RTP  (PARP1_XENLA/1-78,PARP1_CHICK/9-91,(((DNL3_HUMAN/6-98,((PARP_DROME/111-200,PARP_SARPE/114-203),((PARP1_BOVIN/115-205,(PARP1_MOUSE/112-202,PARP1_HUMAN/112-202)),PARP1_CHICK/113-203))),(PARP_DROME/7-89,PARP_SARPE/7-89)),(PARP1_BOVIN/8-92,(PARP1_MOUSE/8-92,PARP1_HUMAN/8-92))));
RTL  5.16686
LNK  DNL3_HUMAN/6-98:P49916:X84740
LNK  PARP1_BOVIN/115-205:P18493:D90073
LNK  PARP1_BOVIN/8-92:P18493:D90073
LNK  PARP1_CHICK/113-203:P26446:X52690
LNK  PARP1_CHICK/9-91:P26446:X52690
LNK  PARP1_HUMAN/112-202:P09874:M18112
LNK  PARP1_HUMAN/8-92:P09874:M32721
LNK  PARP1_MOUSE/112-202:P11103:X14206
LNK  PARP1_MOUSE/8-92:P11103:X14206
LNK  PARP1_XENLA/1-78:P31669:Z12139
LNK  PARP_DROME/111-200:P35875:D13806
LNK  PARP_DROME/7-89:P35875:D13806
LNK  PARP_SARPE/114-203:Q11208:D16482
LNK  PARP_SARPE/7-89:Q11208:D16482
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PARP1_HUMAN/112-202
ASQ  FAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEK-PQLGMIDRWYHPGCFVKN--REELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVK
DSQ  TTTGCAGCAGAGTATGCCAAGTCCAACAGAAGTACGTGCAAGGGGTGTATGGAGAAGATAGAAAAGGGCCAGGTGCGCCTGTCCAAGAAGATGGTGGACCCGGAGAAG---CCACAGCTAGGCATGATTGACCGCTGGTACCATCCAGGCTGCTTTGTCAAGAAC------AGGGAGGAGCTGGGTTTCCGGCCCGAGTACAGTGCGAGTCAGCTCAAGGGCTTCAGCCTCCTTGCTACAGAGGATAAAGAAGCCCTGAAGAAGCAGCTCCCAGGAGTCAAG
TRN  10010101100011011
NAM  PARP1_MOUSE/112-202
ASQ  FAAEYAKSNRSMCKGCLEKIEKGQMRLSKKMVDPEK-PQLGMIDRWYHPTCFVKK--RDELGFRPEYSASQLKGFSLLSAEDKEALKKQLPAIK
DSQ  TTTGCAGCAGAGTATGCCAAGTCCAACAGGAGCATGTGCAAGGGCTGCCTGGAGAAGATAGAGAAGGGCCAGATGCGCCTGTCCAAGAAGATGGTGGATCCAGAGAAG---CCACAGCTGGGTATGATTGACCGCTGGTACCATCCAACTTGCTTTGTCAAGAAG------CGGGACGAGCTGGGCTTCCGGCCCGAGTACAGTGCCAGTCAGCTCAAGGGCTTTAGCCTCCTCTCTGCAGAAGACAAAGAAGCTCTGAAGAAGCAGCTCCCGGCCATCAAG
TRN  10010101100011011
NAM  PARP1_CHICK/113-203
ASQ  FAAEYAKSNRSTCKGCEQKIEKGQIRISKKMVHPEK-PQLGMIDNWYHPDCFVSR--RAELGFLPAYGATQLLGFSILKAEDKETLKKQLPATK
DSQ  TTTGCTGCAGAGTATGCCAAGTCTAACAGGAGTACTTGCAAAGGCTGTGAGCAGAAAATAGAAAAGGGCCAGATTCGGATTTCCAAGAAGATGGTGCATCCTGAGAAA---CCACAGCTGGGGATGATCGATAACTGGTACCACCCGGACTGCTTCGTGAGCCGC------CGGGCAGAGCTGGGCTTCCTCCCAGCATATGGGGCCACACAGCTCCTGGGTTTCAGCATCTTGAAAGCTGAAGATAAAGAAACTCTGAAGAAACAGCTACCAGCTACTAAG
TRN  10010101100011011
NAM  PARP1_BOVIN/115-205
ASQ  FGAGYAKSNRSTCKSCMEKIDKGQVRLSKKVVYPDK-PQLGMVDCWYHPKCFVQK--REELGFRPEFSATHLMGFSVLTAEDQETLKKQLPAIK
DSQ  TTCGGGGCAGGGTACGCCAAGTCCAACAGAAGCACGTGCAAGAGCTGCATGGAGAAGATAGACAAGGGCCAGGTGCGCCTGTCTAAGAAGGTGGTGTACCCCGATAAG---CCCCAGCTGGGCATGGTTGACTGCTGGTACCACCCAAAGTGTTTTGTTCAGAAA------CGGGAGGAGCTGGGCTTCCGTCCCGAGTTCAGCGCAACGCACCTCATGGGCTTCAGCGTCCTCACCGCAGAGGACCAAGAAACCCTCAAGAAGCAACTCCCGGCCATCAAG
TRN  10010101100011011
NAM  PARP_SARPE/114-203
ASQ  FGIEYAKSGRASCRGCEQKILKDQIRIRKTVFDTEVGMKYGGQPLWHHVECFAQL--RGELGWLDTG--ENLPGFQTLKSDDKADVKKALPVIK
DSQ  TTTGGTATAGAATATGCAAAGTCCGGTCGAGCGTCATGCCGAGGATGCGAGCAAAAGATATTAAAGGATCAAATAAGAATACGAAAGACTGTTTTTGACACAGAAGTTGGAATGAAATATGGTGGTCAACCGTTGTGGCATCACGTTGAATGTTTCGCACAATTG------CGCGGTGAATTGGGTTGGCTTGATACCGGA------GAAAATTTACCTGGATTTCAGACATTGAAAAGTGATGACAAAGCAGATGTTAAAAAAGCGCTTCCGGTAATTAAG
TRN  10010101110011000
NAM  PARP_DROME/111-200
ASQ  FGIEYAKSSRSTCRGCEQKINKDLVRLRKTVYDTEVGMKYGGQPLWHHLECFAQL--RSELGWFASG--EDMPGFQSLADDDQAKVKNAIPPIK
DSQ  TTTGGGATTGAATATGCAAAATCTAGTCGATCGACGTGTCGTGGATGTGAACAAAAAATAAACAAGGATCTAGTTCGCTTACGTAAAACTGTTTATGATACTGAAGTTGGTATGAAGTACGGAGGCCAACCTTTGTGGCATCATTTGGAATGCTTCGCCCAATTG------CGCTCTGAGCTTGGCTGGTTTGCGTCAGGT------GAAGATATGCCAGGATTTCAGAGCTTAGCAGATGATGATCAAGCGAAAGTTAAAAACGCCATACCACCAATAAAA
TRN  10010101110011000
NAM  PARP1_HUMAN/8-92
ASQ  YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMF---DGKVPHWYHFSCFWK---VGHSIRHPDV---EVDGFSELRWDDQQKVKKTAEAGG
DSQ  TATCGAGTCGAGTACGCCAAGAGCGGGCGCGCCTCTTGCAAGAAATGCAGCGAGAGCATCCCCAAGGACTCGCTCCGGATGGCCATCATGGTGCAGTCGCCCATGTTT---------GATGGAAAAGTCCCACACTGGTACCACTTCTCCTGCTTCTGGAAG---------GTGGGCCACTCCATCCGGCACCCTGACGTT---------GAGGTGGATGGGTTCTCTGAGCTTCGGTGGGATGACCAGCAGAAAGTCAAGAAGACAGCGGAAGCTGGAGGA
TRN  11011101111011011
NAM  PARP1_MOUSE/8-92
ASQ  YRVQYAKSGRASCKKCSESIPKDSLRMAIMVQSPMF---DGKVPHWYHFSCFWK---VGQSIRHPDV---EVDGFSELRWDDQQKVKKTAEAGG
DSQ  TATCGAGTGCAGTACGCGAAGAGCGGGCGCGCCTCTTGCAAGAAATGCAGCGAGAGTATTCCCAAGGACTCCCTCCGCATGGCCATCATGGTGCAGTCACCCATGTTC---------GATGGGAAAGTCCCACACTGGTACCACTTCTCCTGCTTCTGGAAG---------GTGGGCCAGTCCATCCGGCACCCTGATGTT---------GAGGTGGATGGCTTCTCTGAGCTGCGCTGGGATGATCAGCAGAAGGTCAAGAAGACGGCCGAGGCTGGAGGC
TRN  11011101101011001
NAM  PARP1_BOVIN/8-92
ASQ  YRVEYAKSGRASCKKCKESIPKDSIRMAFMVESPMF---DGKIPHWYHLSCFWK---VGFSIWHPDV---EVEGFSELRWDDQQTIKKMAETGG
DSQ  TACCGGGTCGAGTACGCCAAGAGCGGGCGCGCGTCTTGCAAGAAATGCAAAGAGAGCATCCCCAAGGACTCGATCCGGATGGCCTTCATGGTGGAGTCGCCCATGTTC---------GATGGGAAAATCCCGCACTGGTACCACCTCTCCTGCTTCTGGAAG---------GTCGGCTTCTCCATCTGGCACCCTGATGTC---------GAGGTGGAGGGGTTCTCTGAGCTCCGCTGGGATGACCAGCAGACGATCAAGAAGATGGCCGAGACTGGCGGA
TRN  11011101111011011
NAM  PARP1_XENLA/1-78
ASQ  -----AKSGRASCKKCGDNIAKESLGLAIMVQSPMF---DGKVPHWHHYSCFWK---RARVLSQG-----DIYGYTELRWEDQEMIKKAIETGG
DSQ  ---------------GCTAAGAGCGGTCGCGCCTCTTGCAAGAAATGCGGCGACAACATCGCCAAGGAGTCTCTCGGTCTCGCCATCATGGTGCAGTCCCCAATGTTC---------GATGGCAAAGTTCCGCACTGGCATCACTACTCGTGTTTCTGGAAG---------CGTGCCCGAGTCTTATCCCAAGGG---------------GATATTTATGGTTACACAGAGCTCCGATGGGAAGATCAGGAAATGATTAAGAAAGCCATTGAAACTGGAGGG
TRN  11011101111011010
NAM  PARP1_CHICK/9-91
ASQ  YRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMF---DGKVPHWHHYSCFWK---RARIVSHT-----DIDGFPELRWEDQEKIKKAIETGA
DSQ  TACCGCGCGGAGTACGCCAAGAGCGGGCGGGCGTCGTGCAAGAAGTGTGGCGAGAGCATCGCCAAGGACTCGCTGCGCCTGGCCCTCATGGTGCAGTCGCCCATGTTC---------GATGGCAAAGTCCCTCACTGGCACCACTACAGCTGCTTCTGGAAG---------CGGGCGCGGATCGTGTCCCACACA---------------GACATCGATGGCTTCCCTGAGCTCCGCTGGGAGGACCAGGAGAAAATCAAGAAGGCCATTGAAACCGGAGCC
TRN  11011101101011011
NAM  PARP_SARPE/7-89
ASQ  FKVEYSKSSRASCKGCKNKIEAGILRIAAMVQSAFH---DGKQPNWFHEQCFFQ---KQRPTSAG-----DIENFENIRFEDQERIKKAIDNCT
DSQ  TTTAAAGTAGAATACTCGAAATCTTCAAGAGCATCATGTAAGGGCTGTAAAAATAAAATTGAAGCAGGAATCCTACGTATTGCGGCTATGGTGCAGTCAGCTTTTCAT---------GATGGAAAGCAACCAAACTGGTTCCATGAACAATGTTTTTTTCAA---------AAGCAACGTCCTACTTCTGCTGGA---------------GATATTGAAAATTTTGAAAATATTCGTTTTGAAGATCAAGAAAGAATTAAGAAAGCAATTGATAACTGCACA
TRN  10010101110011001
NAM  PARP_DROME/7-89
ASQ  YLAEYARTGRATCKGCKSTISKDTLRIAVMVQSAFH---DAKVPNWFHKTCFFK---NQRPSSVG-----DIQNIGNLRFADQKELTDLVENIQ
DSQ  TATCTTGCTGAGTATGCAAGAACTGGACGAGCCACTTGCAAAGGATGTAAAAGTACTATATCTAAAGATACTCTTCGGATTGCTGTCATGGTTCAATCTGCATTTCAT---------GATGCCAAAGTTCCGAATTGGTTTCATAAAACCTGCTTTTTTAAA---------AACCAGCGTCCCAGCTCAGTAGGA---------------GACATACAAAACATTGGAAATCTCCGATTTGCCGATCAAAAGGAATTAACGGATCTTGTGGAAAATATACAA
TRN  10010101110011000
NAM  DNL3_HUMAN/6-98
ASQ  FCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFS-ESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLS
DSQ  TTCTGTGTGGACTATGCCAAGCGTGGCACAGCTGGCTGCAAAAAATGCAAGGAAAAGATTGTGAAGGGCGTATGCCGAATTGGCAAAGTGGTGCCCAATCCCTTCTCA---GAGTCTGGGGGTGATATGAAAGAGTGGTACCACATTAAATGCATGTTTGAGAAACTAGAGCGGGCCCGGGCCACCACAAAAAAAATCGAGGACCTCACAGAGCTGGAAGGCTGGGAAGAGCTGGAAGATAATGAGAAGGAACAGATAACCCAGCACATTGCAGATCTGTCT
TRN  10010101100011001
//