EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00624 - Flocculin)
FAM  PF00624
PID  Flocculin
DES  Flocculin repeat
IPR  IPR001389
ANO  5
ALN  45
AID  0.754704
APH  ((FLO1_YEAST/947-991:0.17306,YH13_YEAST/133-177:0.17067):0.06590,(FLO1_YEAST/317-361:0.08323,FLO1_YEAST/452-496:0.17469):0.10204,FLO1_YEAST/272-316:0.05865);
ATP  ((FLO1_YEAST/947-991,YH13_YEAST/133-177),(FLO1_YEAST/317-361,FLO1_YEAST/452-496),FLO1_YEAST/272-316);
ATL  0.82824
DNO  5
DLN  135
DID  0.759259
DPH  ((FLO1_YEAST/947-991:0.21816,YH13_YEAST/133-177:0.11237):0.07900,(FLO1_YEAST/317-361:0.11549,FLO1_YEAST/452-496:0.11340):0.05791,FLO1_YEAST/272-316:0.05982);
DTP  ((FLO1_YEAST/947-991,YH13_YEAST/133-177),(FLO1_YEAST/317-361,FLO1_YEAST/452-496),FLO1_YEAST/272-316);
DTL  0.75615
RID  0.754704
RPH  ((FLO1_YEAST/947-991:0.17306,YH13_YEAST/133-177:0.17067):0.06590,(FLO1_YEAST/317-361:0.08323,FLO1_YEAST/452-496:0.17469):0.10204,FLO1_YEAST/272-316:0.05865);
RTP  ((FLO1_YEAST/947-991,YH13_YEAST/133-177),(FLO1_YEAST/317-361,FLO1_YEAST/452-496),FLO1_YEAST/272-316);
RTL  0.82824
LNK  FLO1_YEAST/272-316:P32768:X78160
LNK  FLO1_YEAST/317-361:P32768:X78160
LNK  FLO1_YEAST/452-496:P32768:X78160
LNK  FLO1_YEAST/947-991:P32768:X78160
LNK  YH13_YEAST/133-177:P38896:U00029
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YH13_YEAST/133-177
ASQ  TTSIVTTTTELWTGTFTSTSTEMTTVTGTNGQPTDETVIVAKAPT
DSQ  ACTACTAGCATCGTCACAACTACTACCGAACTGTGGACTGGTACTTTTACTTCTACATCTACTGAAATGACCACCGTCACCGGTACTAATGGTCAACCAACTGACGAAACCGTTATTGTTGCCAAAGCTCCAACC
TRN  11011101101011011
NAM  FLO1_YEAST/947-991
ASQ  SEGLISTTTEPWTGTFTSTSTEVTTITGTNGQPTDETVIVIRTPT
DSQ  AGTGAAGGTCTAATCAGCACCACCACTGAACCATGGACTGGCACTTTCACTTCGACTTCCACTGAGGTTACCACCATCACTGGAACCAACGGTCAACCAACTGACGAAACTGTGATTGTTATCAGAACTCCAACC
TRN  10010101110011011
NAM  FLO1_YEAST/452-496
ASQ  TATTAMTTTQPWDDTFTSTSTEMTTVTGTNGLPTDETIIVIRTPT
DSQ  ACAGCCACTACTGCTATGACTACAACTCAGCCATGGGACGACACTTTTACCTCTACATCCACTGAAATGACCACCGTCACCGGTACCAACGGTTTGCCAACTGATGAAACCATCATTGTCATCAGAACACCAACA
TRN  10110101110011011
NAM  FLO1_YEAST/317-361
ASQ  TASTIITTTEPWNSTFTSTSTELTTVTGTNGVRTDETIIVIRTPT
DSQ  ACTGCTAGCACCATCATAACTACAACTGAGCCATGGAACAGCACTTTTACCTCTACTTCTACCGAATTGACCACAGTCACTGGCACCAATGGTGTACGAACTGACGAAACCATCATTGTAATCAGAACACCAACA
TRN  10010101110011011
NAM  FLO1_YEAST/272-316
ASQ  AVSTTTTTTEPWTGTFTSTSTEMTTVTGTNGVPTDETVIVIRTPT
DSQ  GCTGTCAGTACCACTACAACTACAACGGAACCATGGACCGGTACTTTCACTTCTACATCTACTGAAATGACCACCGTCACCGGTACCAACGGCGTTCCAACTGACGAAACCGTCATTGTCATCAGAACTCCAACA
TRN  10110101110011011
//