EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00570 - HRDC)
FAM  PF00570
PID  HRDC
DES  HRDC domain
IPR  IPR002121
ANO  29
ALN  83
AID  0.219901
APH  ((Q49764_MYCLE/161-242:0.66837,((RND_ECOLI/210-289:0.58764,RND_HAEIN/239-318:0.59553):0.48413,((O07183_MYCTU/245-325:0.54334,O69858_STRCO/214-293:0.39572):0.75333,(((PMC2_HUMAN/503-583:0.26745,Q9VFF3_DROME/485-565:0.20266):0.15890,Q17951_CAEEL/489-569:0.43385):0.45358,((RRP6_YEAST/435-515:0.85905,YD81_SCHPO/442-522:0.52773):0.27034,Q9SLI9_ARATH/336-414:0.93625):0.00000):0.45494):0.15416):0.65247):0.21041,(((Q9RUU2_DEIRA/652-732:0.79919,Q9RUU2_DEIRA/750-824:0.30695):0.43990,(Q9RUU2_DEIRA/534-614:0.48164,Q9XAR9_STRCO/556-635:0.50781):0.18922):0.17771,(Q9ZHY4_NEIGO/525-605:0.51885,(Q9ZHY4_NEIGO/692-766:0.74630,Q9ZHY4_NEIGO/613-691:0.85804):0.20518):0.28498):0.09106,((O34748_BACSU/513-591:0.49852,(RECQ_ECOLI/528-608:0.24542,RECQ_HAEIN/535-615:0.36218):0.33617):0.00000,((BLM_HUMAN/1212-1292:0.73851,(BLM_CAEEL/807-888:1.06705,BLM_DROME/1283-1363:0.89850):0.14951):0.19675,(SGS1_YEAST/1272-1351:1.38843,((WRN_XENLA/1098-1177:0.28058,(WRN_MOUSE/1115-1194:0.16356,WRN_HUMAN/1150-1229:0.07030):0.07341):0.76692,HUS2_SCHPO/1115-1195:0.69184):0.18884):0.28093):0.32250):0.23260);
ATP  ((Q49764_MYCLE/161-242,((RND_ECOLI/210-289,RND_HAEIN/239-318),((O07183_MYCTU/245-325,O69858_STRCO/214-293),(((PMC2_HUMAN/503-583,Q9VFF3_DROME/485-565),Q17951_CAEEL/489-569),((RRP6_YEAST/435-515,YD81_SCHPO/442-522),Q9SLI9_ARATH/336-414))))),(((Q9RUU2_DEIRA/652-732,Q9RUU2_DEIRA/750-824),(Q9RUU2_DEIRA/534-614,Q9XAR9_STRCO/556-635)),(Q9ZHY4_NEIGO/525-605,(Q9ZHY4_NEIGO/692-766,Q9ZHY4_NEIGO/613-691))),((O34748_BACSU/513-591,(RECQ_ECOLI/528-608,RECQ_HAEIN/535-615)),((BLM_HUMAN/1212-1292,(BLM_CAEEL/807-888,BLM_DROME/1283-1363)),(SGS1_YEAST/1272-1351,((WRN_XENLA/1098-1177,(WRN_MOUSE/1115-1194,WRN_HUMAN/1150-1229)),HUS2_SCHPO/1115-1195)))));
ATL  24.1692
DNO  28
DLN  249
DID  0.368166
DPH  (((((((((((((RND_ECOLI/210-289:0.22708,RND_HAEIN/239-318:0.66965):0.34791,((((PMC2_HUMAN/503-583:0.19405,Q9VFF3_DROME/485-565:0.31339):0.10401,Q17951_CAEEL/489-569:0.39313):0.28214,RRP6_YEAST/435-515:0.65406):0.10595,Q9SLI9_ARATH/336-414:0.41159):0.38481):0.11040,(O07183_MYCTU/245-325:0.41500,O69858_STRCO/214-293:0.25327):0.38236):0.17930,((Q9ZHY4_NEIGO/525-605:0.20918,Q9ZHY4_NEIGO/613-691:0.55489):0.15408,Q9ZHY4_NEIGO/692-766:0.33874):0.14487):0.05670,(Q9RUU2_DEIRA/534-614:0.30320,((Q9RUU2_DEIRA/652-732:0.49115,Q9RUU2_DEIRA/750-824:0.28776):0.16765,Q9XAR9_STRCO/556-635:0.35534):0.09697):0.12498):0.11880,Q49764_MYCLE/161-242:0.41460):0.30523,O34748_BACSU/513-591:0.35662):0.04769,(RECQ_ECOLI/528-608:0.37474,RECQ_HAEIN/535-615:0.24506):0.16393):0.14177,SGS1_YEAST/1272-1351:0.74245):0.14303,((BLM_CAEEL/807-888:0.63518,HUS2_SCHPO/1115-1195:0.62302):0.03124,BLM_HUMAN/1212-1292:0.53174):0.08752):0.13973,BLM_DROME/1283-1363:0.60185):0.36704,WRN_XENLA/1098-1177:0.26359):0.09160,WRN_MOUSE/1115-1194:0.12694,WRN_HUMAN/1150-1229:0.07635);
DTP  (((((((((((((RND_ECOLI/210-289,RND_HAEIN/239-318),((((PMC2_HUMAN/503-583,Q9VFF3_DROME/485-565),Q17951_CAEEL/489-569),RRP6_YEAST/435-515),Q9SLI9_ARATH/336-414)),(O07183_MYCTU/245-325,O69858_STRCO/214-293)),((Q9ZHY4_NEIGO/525-605,Q9ZHY4_NEIGO/613-691),Q9ZHY4_NEIGO/692-766)),(Q9RUU2_DEIRA/534-614,((Q9RUU2_DEIRA/652-732,Q9RUU2_DEIRA/750-824),Q9XAR9_STRCO/556-635))),Q49764_MYCLE/161-242),O34748_BACSU/513-591),(RECQ_ECOLI/528-608,RECQ_HAEIN/535-615)),SGS1_YEAST/1272-1351),((BLM_CAEEL/807-888,HUS2_SCHPO/1115-1195),BLM_HUMAN/1212-1292)),BLM_DROME/1283-1363),WRN_XENLA/1098-1177),WRN_MOUSE/1115-1194,WRN_HUMAN/1150-1229);
DTL  15.2679
RID  0.220863
RPH  ((Q49764_MYCLE/161-242:0.64798,((RND_ECOLI/210-289:0.52974,RND_HAEIN/239-318:0.65055):0.45188,((O07183_MYCTU/245-325:0.51523,O69858_STRCO/214-293:0.41492):0.71125,((((PMC2_HUMAN/503-583:0.26452,Q9VFF3_DROME/485-565:0.20454):0.15940,Q17951_CAEEL/489-569:0.43936):0.42073,RRP6_YEAST/435-515:1.02160):0.11193,Q9SLI9_ARATH/336-414:0.84446):0.37185):0.17622):0.70744):0.22583,((O34748_BACSU/513-591:0.49972,(RECQ_ECOLI/528-608:0.24645,RECQ_HAEIN/535-615:0.36051):0.33276):0.00000,((BLM_HUMAN/1212-1292:0.74241,(BLM_CAEEL/807-888:1.06805,BLM_DROME/1283-1363:0.89386):0.14497):0.19510,(SGS1_YEAST/1272-1351:1.38726,(HUS2_SCHPO/1115-1195:0.69057,(WRN_XENLA/1098-1177:0.28000,(WRN_MOUSE/1115-1194:0.16319,WRN_HUMAN/1150-1229:0.07030):0.07333):0.76401):0.18911):0.28002):0.32830):0.23787,((Q9ZHY4_NEIGO/525-605:0.52261,(Q9ZHY4_NEIGO/692-766:0.74075,Q9ZHY4_NEIGO/613-691:0.85736):0.20157):0.28318,((Q9RUU2_DEIRA/652-732:0.79564,Q9RUU2_DEIRA/750-824:0.30671):0.43787,(Q9RUU2_DEIRA/534-614:0.48263,Q9XAR9_STRCO/556-635:0.50302):0.18925):0.17360):0.09296);
RTP  ((Q49764_MYCLE/161-242,((RND_ECOLI/210-289,RND_HAEIN/239-318),((O07183_MYCTU/245-325,O69858_STRCO/214-293),((((PMC2_HUMAN/503-583,Q9VFF3_DROME/485-565),Q17951_CAEEL/489-569),RRP6_YEAST/435-515),Q9SLI9_ARATH/336-414)))),((O34748_BACSU/513-591,(RECQ_ECOLI/528-608,RECQ_HAEIN/535-615)),((BLM_HUMAN/1212-1292,(BLM_CAEEL/807-888,BLM_DROME/1283-1363)),(SGS1_YEAST/1272-1351,(HUS2_SCHPO/1115-1195,(WRN_XENLA/1098-1177,(WRN_MOUSE/1115-1194,WRN_HUMAN/1150-1229)))))),((Q9ZHY4_NEIGO/525-605,(Q9ZHY4_NEIGO/692-766,Q9ZHY4_NEIGO/613-691)),((Q9RUU2_DEIRA/652-732,Q9RUU2_DEIRA/750-824),(Q9RUU2_DEIRA/534-614,Q9XAR9_STRCO/556-635))));
RTL  23.4044
LNK  BLM_CAEEL/807-888:O18017:AY095296
LNK  BLM_DROME/1283-1363:Q9VGI8:U92536
LNK  BLM_HUMAN/1212-1292:P54132:U39817
LNK  HUS2_SCHPO/1115-1195:Q09811:Y09426
LNK  O07183_MYCTU/245-325:O07183:BX842580
LNK  O34748_BACSU/513-591:O34748:AF027868
LNK  O69858_STRCO/214-293:O69858:AL939126
LNK  PMC2_HUMAN/503-583:Q01780:X66113
LNK  Q17951_CAEEL/489-569:Q17951:Z49909
LNK  Q49764_MYCLE/161-242:Q49764:U00016
LNK  Q9RUU2_DEIRA/534-614:Q9RUU2:AE001976
LNK  Q9RUU2_DEIRA/652-732:Q9RUU2:AE001976
LNK  Q9RUU2_DEIRA/750-824:Q9RUU2:AE001976
LNK  Q9SLI9_ARATH/336-414:Q9SLI9:AC005287
LNK  Q9VFF3_DROME/485-565:Q9VFF3:AE003706
LNK  Q9XAR9_STRCO/556-635:Q9XAR9:AL939120
LNK  Q9ZHY4_NEIGO/525-605:Q9ZHY4:AF047374
LNK  Q9ZHY4_NEIGO/613-691:Q9ZHY4:AF047374
LNK  Q9ZHY4_NEIGO/692-766:Q9ZHY4:AF047374
LNK  RECQ_ECOLI/528-608:P15043:U00096
LNK  RECQ_HAEIN/535-615:P71359:U32756
LNK  RND_ECOLI/210-289:P09155:X07055
LNK  RND_HAEIN/239-318:P44442:U32722
LNK  RRP6_YEAST/435-515:Q12149:Z74909
LNK  SGS1_YEAST/1272-1351:P35187:L07870
LNK  WRN_HUMAN/1150-1229:Q14191:L76937
LNK  WRN_MOUSE/1115-1194:O09053:D86527
LNK  WRN_XENLA/1098-1177:O93530:AF067418
LNK  YD81_SCHPO/442-522:Q10146:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9SLI9_ARATH/336-414
ASQ  VQLSIVALQGLCEWRDRIARADDES.TGYVLPNKTLFDIAKEMPIVVAQLRRLLKSKLPYLERNFDAVISVIR.RS--MQNAA
DSQ  GTTCAACTTTCCATTGTTGCGCTGCAGGGGCTTTGTGAATGGCGGGATCGGATTGCACGCGCAGATGATGAGAGC...ACCGGTTATGTATTGCCAAATAAAACTCTTTTTGACATAGCCAAGGAGATGCCAATTGTTGTTGCCCAGTTGCGCCGTTTGTTGAAGTCAAAGCTTCCTTACCTCGAGCGTAATTTTGACGCAGTGATCAGTGTCATCAGA...CGATCA------ATGCAAAATGCAGCG
TRN  10010101100011001
NAM  YD81_SCHPO/442-522
ASQ  GREALMIYRALHDWRDSVARKEDES.VRYVLPNRLLIAIAASKPVEAADVFSISKQLTPIARMYVEDIVKVVQ.EAEKLYNEQ
NAM  RRP6_YEAST/435-515
ASQ  PPEREVLVRELYQWRDLIARRDDES.PRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEHVRQNAKLLANLIR.DALRNIKNT
DSQ  CCACCTGAGAGGGAAGTATTAGTAAGAGAGCTATACCAATGGAGAGATCTTATTGCAAGAAGAGACGATGAATCG...CCACGATTTGTTATGCCAAACCAGTTATTGGCTGCACTTGTCGCATATACACCTACTGATGTCATAGGTGTTGTTTCTTTGACCAATGGCGTAACTGAACATGTCCGCCAGAATGCAAAACTATTAGCTAATTTGATAAGA...GATGCATTACGAAACATCAAGAACACC
TRN  10010101110011010
NAM  Q17951_CAEEL/489-569
ASQ  NTRQDYALTHLFKWRDVVARAEDES.PHFVLPNHMMLSLSETLPRDVGGIYACCNPLPYFVKQRTGDILKIIV.EARDVKLEK
DSQ  AATACTCGACAGGACTATGCACTTACACATCTTTTCAAATGGAGAGATGTAGTAGCTAGAGCAGAAGATGAGAGC...CCACATTTTGTACTTCCAAATCATATGATGCTATCACTTTCTGAGACATTACCACGAGATGTTGGAGGTATCTACGCGTGTTGTAACCCGTTACCGTACTTTGTGAAACAGCGAACTGGTGATATTTTGAAAATAATTGTG...GAGGCCAGAGATGTGAAGCTTGAGAAA
TRN  10010101110011000
NAM  Q9VFF3_DROME/485-565
ASQ  DNRQLYALRGIFEWRDATARSEDES.YGYVLPNHMMLQIAESLPREMQGILACCNPIPPLVRQQLHTLHQIVL.KARDQPLVK
DSQ  GACAACCGGCAACTGTACGCACTTCGCGGAATCTTCGAGTGGCGCGATGCGACGGCGCGGTCAGAGGACGAGAGT...TACGGCTATGTGCTGCCCAATCACATGATGCTGCAAATCGCTGAGAGTCTTCCAAGGGAGATGCAGGGAATCCTCGCCTGCTGCAATCCCATTCCGCCGCTGGTGCGCCAACAGCTGCACACGCTTCACCAGATTGTCCTC...AAGGCGCGCGATCAGCCGCTGGTCAAA
TRN  10010101100011001
NAM  PMC2_HUMAN/503-583
ASQ  NTQQLTAFQLLFAWRDKTARREDES.YGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQ.QAREMPLLK
DSQ  AACACACAGCAGTTGACAGCCTTTCAGCTGCTGTTTGCCTGGAGGGATAAAACAGCTCGCAGGGAAGATGAAAGT...TACGGATATGTACTGCCAAACCACATGATGCTGAAAATAGCTGAAGAACTGCCTAAGGAACCTCAGGGCATCATAGCTTGCTGCAACCCAGTACCGCCCCTTGTGCGGCAGCAGATCAACGAAATGCACCTTTTAATCCAG...CAGGCCCGAGAGATGCCCCTGCTCAAG
TRN  10010101100011010
NAM  O69858_STRCO/214-293
ASQ  RRRQLAVVRELWQARDRIAQRRDVS.PGKVLGDAAIVEAALALPPNAHALAALNGFGRVNRRQLEQ-WQLSVD.RARALSESQ
DSQ  AGGCGCCGCCAGCTCGCCGTGGTGCGGGAGCTGTGGCAGGCCCGGGACCGGATCGCGCAGCGCCGGGACGTCTCC...CCCGGCAAGGTGCTCGGGGACGCGGCCATCGTCGAGGCCGCCCTCGCGCTGCCGCCCAACGCGCACGCGCTGGCCGCGCTGAACGGGTTCGGCAGGGTGAACCGCCGGCAGCTGGAGCAG---TGGCAGCTGTCGGTCGAC...CGGGCCAGGGCGCTGTCCGAGTCGCAG
TRN  10010101100011011
NAM  O07183_MYCTU/245-325
ASQ  DRRGLAAVRELWTARDRIAQRRDIA.PRRILPDSAIIDAAIADPKSVDDLVALPVFGGRNQRRSAAVWWAALA.AARESPDPP
DSQ  GACCGGCGGGGGCTGGCCGCGGTCCGCGAATTGTGGACAGCGCGTGACCGAATCGCCCAGCGCCGCGACATCGCG...CCCCGCCGGATCTTGCCGGACTCGGCCATTATCGATGCCGCCATCGCCGACCCAAAGTCAGTCGACGACCTTGTCGCGTTACCGGTGTTCGGCGGACGCAACCAACGTCGCAGCGCGGCTGTGTGGTGGGCGGCACTGGCA...GCCGCACGCGAAAGCCCAGATCCGCCG
TRN  11011111101111100
NAM  RND_HAEIN/239-318
ASQ  NPLELSRLRVLAQWRQNVAIERDLA.LSYIVKSEHLWKVAKNNPRNTSEMLEM-GLTENEVRVRGKEILQLLS.QARRISSND
DSQ  AATCCATTAGAATTGTCTCGTTTAAGAGTTTTGGCACAGTGGCGACAAAACGTGGCAATAGAACGTGATTTAGCA...CTTTCTTATATTGTGAAATCAGAACATCTTTGGAAAGTGGCAAAGAATAATCCACGTAATACATCTGAAATGTTAGAAATG---GGATTAACTGAAAATGAAGTGCGTGTACGTGGTAAGGAAATTCTACAATTACTTTCT...CAAGCAAGACGTATTTCGTCTAATGAC
TRN  10010101110011000
NAM  RND_ECOLI/210-289
ASQ  RTRQLACLQLLADWRLRKARERDLA.VNFVVREEHLWSVARYMPGSLGELDSL-GLSGSEIRFHGKTLLALVE.KAQTLPEDA
DSQ  CGCACACGCCAACTGGCCTGTCTGCAACTGTTAGCCGACTGGCGACTGCGCAAGGCGCGAGAGCGCGATCTGGCG...GTGAACTTTGTCGTGCGTGAAGAGCATTTGTGGTCGGTAGCGCGTTATATGCCGGGAAGTTTAGGCGAACTGGACAGCCTG---GGTTTATCCGGTAGCGAAATCCGCTTTCACGGTAAAACGCTGCTAGCGCTGGTGGAA...AAAGCGCAGACATTGCCGGAAGATGCC
TRN  11011101101011010
NAM  SGS1_YEAST/1272-1351
ASQ  LNNLRMTYERLRELSLNLGNRMVPP.VGNFMPDSILKKMAAILPMNDSAFATL-GTVEDKYRRRFKYFKATIA.DLSKKRSSE
DSQ  CTTAATAATCTGCGAATGACATACGAACGTCTGAGGGAATTATCTTTAAATTTAGGAAATAGAATGGTTCCTCCA...GTTGGGAACTTTATGCCTGACAGTATTTTAAAAAAGATGGCAGCAATATTACCAATGAATGATTCGGCTTTTGCAACTTTA---GGCACAGTGGAGGACAAATATCGCCGAAGGTTCAAGTACTTTAAAGCCACGATAGCA...GATCTTAGCAAAAAGAGATCAAGCGAG
TRN  10010101100011000
NAM  Q9ZHY4_NEIGO/692-766
ASQ  AKHKRCLMRALIQWCNETAKHEQSE.PYRILSKAALRAIAAKQPEGLAELAAVYGVGEEKAARYGAAVSAVLE.------RDA
DSQ  GCCAAACACAAACGCTGCCTGATGCGCGCCCTGATTCAATGGTGCAACGAAACCGCAAAACACGAACAGTCCGAA...CCCTACCGCATTCTCAGCAAAGCCGCCCTGCGCGCCATTGCCGCCAAACAGCCGGAAGGTTTGGCGGAGCTTGCCGCCGTATACGGCGTAGGCGAAGAAAAAGCCGCACGTTACGGTGCGGCGGTGTCGGCGGTGTTGGAA...------------------CGGGATGCC
TRN  11011101101011011
NAM  Q9XAR9_STRCO/556-635
ASQ  PAELVPAFEALRAWRAEQAREQGVP.AYVIFHDATLREIVTVWPTSVGQLGGISGVGEKKLATYGEGVVEAL-.AGLEGPGSA
DSQ  CCGGCGGAGCTGGTCCCCGCCTTCGAGGCGCTGCGCGCCTGGCGCGCGGAACAGGCTCGAGAGCAGGGCGTCCCG...GCGTACGTCATCTTCCACGACGCCACCCTGCGGGAGATCGTCACCGTGTGGCCCACCTCGGTCGGGCAGCTCGGGGGCATCAGCGGGGTCGGCGAGAAGAAGCTGGCGACGTACGGCGAGGGCGTGGTCGAGGCGCTG---...GCGGGGCTGGAGGGACCGGGTTCCGCC
TRN  11011111101111111
NAM  Q9RUU2_DEIRA/534-614
ASQ  DSHDAPLFEALRAWRLQKAKELSLP.PYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVR.DSSGGGQAG
DSQ  GACAGCCACGACGCCCCGCTGTTCGAGGCGCTGCGGGCGTGGCGACTGCAAAAGGCGAAGGAGCTGAGCCTACCG...CCCTACACTATCTTTCACGACGCGACCCTCAAAACGATTGCCGAGCTGCGCCCCGGCAGCCACGCGACTCTCGGCACCGTGAGCGGCGTCGGCGGACGCAAACTGGCGGCCTACGGCGACGAGGTGTTGCAGGTCGTGCGC...GACTCCAGCGGCGGGGGCCAGGCGGGA
TRN  11011101101011011
NAM  Q49764_MYCLE/161-242
ASQ  ADVDEELLLQLKAWRLSTAKEQNVP.AYVVLTDNTLIAIAELLPADEAALIAVPGMSVRKIEQYGSDVLQLVRcRAVAVRTQT
DSQ  GCAGACGTTGACGAAGAATTGTTGCTGCAGCTCAAAGCGTGGCGGCTTAGCACTGCCAAGGAACAGAACGTGCCT...GCTTACGTCGTTTTAACCGATAACACGTTGATTGCGATTGCTGAGTTGCTGCCCGCCGATGAGGCCGCGTTGATCGCTGTCCCGGGTATGAGTGTACGCAAAATTGAGCAATACGGGTCGGACGTGCTGCAGTTGGTTCGCtgcCGTGCCGTCGCGGTTAGGACGCAGACC
TRN  10010101100011010
NAM  RECQ_HAEIN/535-615
ASQ  ANYDKDLFARLRFLRKQIADKENIP.PYIVFNDATLQEMAQYMPTSNIEMLQINGVGSIKLERFGQPFMALIQ.EHKAILANA
DSQ  GCAAATTACGATAAGGATTTATTTGCACGCTTGCGTTTCTTACGCAAACAAATTGCCGATAAAGAAAATATTCCG...CCGTACATTGTCTTTAATGATGCGACTTTGCAAGAAATGGCACAATATATGCCAACAAGCAATATTGAAATGCTGCAAATTAATGGCGTGGGCTCTATCAAATTAGAGCGGTTTGGGCAGCCGTTTATGGCATTGATTCAA...GAACATAAGGCAATTTTGGCGAATGCG
TRN  11011101101011010
NAM  RECQ_ECOLI/528-608
ASQ  GNYDRKLFAKLRKLRKSIADESNVP.PYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIR.AHVDGDDEE
DSQ  GGCAACTATGATCGCAAACTGTTCGCCAAATTACGCAAACTGCGTAAATCGATAGCCGATGAAAGTAATGTCCCG...CCGTACGTGGTGTTTAACGACGCAACCTTGATTGAGATGGCTGAACAGATGCCGATCACCGCCAGCGAAATGCTCAGCGTTAACGGCGTTGGGATGCGCAAGCTGGAACGCTTTGGCAAACCGTTTATGGCGCTGATTCGT...GCGCATGTTGATGGCGATGACGAAGAG
TRN  10010101100011010
NAM  O34748_BACSU/513-591
ASQ  ITENDELFERLRMVRKEIAAEQGVP.PFVVFSDQTLKEMSGKQPVNDDELLSIKGVGEQKRAKYGRLFLQEIQ.AYARMT--D
DSQ  ATTACTGAAAATGACGAGCTATTTGAACGATTGCGCATGGTTCGGAAAGAAATTGCGGCTGAGCAGGGTGTTCCG...CCATTTGTTGTTTTCTCTGACCAAACGTTAAAAGAAATGTCAGGAAAACAGCCCGTAAATGATGATGAACTTTTGTCTATAAAAGGAGTCGGAGAACAAAAAAGAGCAAAATACGGCCGGCTTTTTTTACAAGAAATACAG...GCTTATGCAAGGATGACA------GAC
TRN  10010101110011000
NAM  Q9RUU2_DEIRA/750-824
ASQ  PNAD--LSEALRELRRELMKETGYS.AFVVFTNATLEALAARQPRTLAELAEVPGLGEKRIEAYGERILDAIN.TVLD----G
DSQ  CCCAACGCCGAC------CTCAGCGAAGCCCTGCGCGAGCTGCGGCGTGAGCTGATGAAGGAAACGGGCTACAGC...GCCTTCGTCGTGTTCACCAACGCCACGCTCGAAGCCCTCGCCGCCCGGCAGCCGCGCACGCTCGCCGAGCTGGCCGAGGTGCCGGGTCTGGGCGAAAAGCGCATCGAGGCGTATGGGGAACGGATTCTGGATGCGATCAAC...ACGGTGCTCGAT------------GGA
TRN  11011111101111111
NAM  Q9RUU2_DEIRA/652-732
ASQ  KPAHPGVLGALRELRRTLAAEQGRS.LSWVFPEATIDELARKLPTRSEELKDVFGLGGQRIQAFGDRILATIR.AELTGGAPS
DSQ  AAGCCCGCGCATCCCGGCGTGTTGGGTGCCCTCCGCGAACTGCGGCGCACGCTCGCCGCCGAGCAGGGGCGCTCG...CTGTCGTGGGTCTTTCCCGAGGCGACCATCGACGAACTCGCCCGCAAACTGCCCACCCGCAGCGAGGAGCTGAAGGACGTGTTCGGACTGGGAGGCCAGCGGATTCAGGCGTTCGGGGACCGGATTCTGGCGACCATTCGG...GCCGAGTTGACGGGGGGTGCGCCATCG
TRN  11011101101011011
NAM  Q9ZHY4_NEIGO/613-691
ASQ  REQQ--LRQKLEAWRYEQARAENCA.LHTVLSDESLADMLAATPETETDLEAVHGLGSVRAAKYGRDILAVCR.PFSDGIDET
DSQ  CGCGAACAACAA------CTGCGTCAAAAACTCGAAGCCTGGCGGTATGAACAGGCAAGGGCGGAAAACTGCGCC...CTGCATACCGTCCTCTCCGACGAAAGCCTTGCCGATATGCTTGCCGCCACGCCCGAAACCGAAACCGACCTCGAAGCCGTACACGGCTTGGGCAGCGTACGCGCCGCCAAATACGGACGGGACATCCTCGCCGTCTGCCGT...CCGTTTTCAGACGGCATCGATGAAACC
TRN  10010101100011001
NAM  Q9ZHY4_NEIGO/525-605
ASQ  TEREERLWQALRVWRMKQAEAEGIP.AYMIFGDKTLRDLVEKMPQNLNGLHDIYGLGEAKTERFGHGILKVCQ.NAADFSHDA
DSQ  ACCGAACGCGAAGAACGCCTGTGGCAGGCATTGCGCGTTTGGCGCATGAAACAGGCTGAAGCCGAAGGCATCCCC...GCCTATATGATTTTCGGCGACAAAACCCTGCGCGACCTTGTCGAAAAAATGCCGCAAAACCTCAACGGGCTGCACGACATCTACGGCTTGGGCGAAGCCAAAACCGAACGTTTCGGACACGGCATACTCAAAGTCTGCCAA...AACGCTGCCGACTTTAGCCACGATGCC
TRN  10010101100011011
NAM  WRN_HUMAN/1150-1229
ASQ  QETQIVLYGKLVEARQKHANKMDVP.PAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAP-LLEVIK.HFCQTNSVQ
DSQ  CAGGAGACTCAGATTGTGTTATATGGCAAATTGGTAGAAGCTAGGCAGAAACATGCCAATAAAATGGATGTTCCC...CCAGCTATTCTGGCAACAAACAAGATACTGGTGGATATGGCCAAAATGAGACCAACTACGGTTGAAAACGTAAAAAGGATTGATGGTGTTTCTGAAGGCAAAGCTGCCATGTTGGCCCCT---CTGTTGGAAGTCATCAAA...CATTTCTGCCAAACAAATAGTGTTCAG
TRN  10010101100011010
NAM  WRN_MOUSE/1115-1194
ASQ  LDARTGLYARLVEARQKHANKMDVP.PAILATNKVLLDMAKMRPTTVENMKQIDGVSEGKAALLAP-LVGVIK.HFCQVTSVQ
DSQ  CTGGACGCTCGGACTGGGCTATATGCCAGGTTGGTGGAAGCAAGGCAGAAACACGCTAATAAGATGGATGTACCT...CCAGCTATTTTAGCAGCAAACAAGGTTTTGCTGGACATGGCTAAAATGAGACCGACTACTGTTGAAAACATGAAACAGATCGACGGTGTCTCTGAAGGCAAAGCTGCTCTGTTGGCCCCT---CTGGTGGGAGTCATCAAA...CATTTCTGTCAAGTAACTAGTGTTCAG
TRN  10010101100011010
NAM  WRN_XENLA/1098-1177
ASQ  RELQTTLYGRLVVARQKIASERDIL.PAVLATNKVLVDMAKLRPTTSENMKKLDGVSEAKSAMLAP-LLEVVK.EFCIANSLK
DSQ  AGGGAACTTCAGACAACTCTATATGGCAGATTGGTAGTAGCTAGACAGAAGATAGCTAGTGAGAGGGATATACTT...CCTGCTGTCCTAGCTACCAACAAAGTATTAGTAGACATGGCAAAATTAAGGCCAACCACAAGCGAAAATATGAAGAAACTAGATGGAGTGTCAGAAGCCAAGTCAGCAATGCTTGCCCCC---CTGTTGGAAGTTGTCAAA...GAGTTCTGCATTGCCAATAGTTTAAAG
TRN  10010101100011000
NAM  HUS2_SCHPO/1115-1195
ASQ  IDVMTRCLKDLKLLRSNLMAIDDSR.VSSYFTDSVLLSMAKKLPRNVKELKEIHGVSNEKAVNLGPKFLQVIQ.KFIDEKEQN
DSQ  ATAGATGTTATGACTCGCTGTCTAAAAGACCTTAAACTTTTAAGAAGCAACTTAATGGCCATAGATGACAGCAGA...GTGTCTTCGTATTTCACAGATTCCGTATTACTAAGTATGGCCAAAAAGCTTCCCAGGAATGTAAAGGAATTAAAGGAAATACACGGTGTAAGTAATGAAAAAGCTGTAAATTTAGGGCCTAAATTTTTACAAGTGATTCAA...AAATTCATTGACGAGAAAGAACAAAAT
TRN  10010101110011010
NAM  BLM_DROME/1283-1363
ASQ  REIHERCYTDLLDLCRTIASQRNVT.MASIMNIQALKSMAETLPITEKDMCSIPHVTKANFDKYGAKLLEITS.NYASEKLLM
DSQ  CGGGAGATTCACGAGCGTTGCTATACAGATCTATTGGATCTATGTCGAACCATTGCCAGCCAGCGAAACGTTACC...ATGGCTAGTATCATGAACATTCAGGCCCTGAAGAGCATGGCCGAAACACTACCAATCACCGAGAAGGACATGTGCAGCATTCCGCACGTGACCAAGGCGAACTTTGATAAATACGGCGCCAAGCTGCTCGAAATCACTAGC...AACTATGCATCGGAGAAGCTGCTGATG
TRN  11011101101011011
NAM  BLM_CAEEL/807-888
ASQ  GDVFTRCLQDLTHLITAVAESSGLSgPYSIVSREGIEQIAALLPRTNSDLLRIDSMTQIKVTKYGRLIMELLA.TYWKQVDER
DSQ  GGAGATGTTTTTACGAGATGTCTTCAAGATTTGACTCATCTTATTACTGCAGTTGCCGAGAGTTCTGGATTATCCggtCCTTATTCAATTGTGTCCCGAGAAGGAATCGAACAAATCGCTGCTCTTCTTCCACGGACGAATTCGGATCTTTTGAGAATTGATTCCATGACCCAGATTAAAGTTACAAAGTATGGCCGTCTAATCATGGAGCTTCTAGCA...ACTTACTGGAAACAGGTTGATGAACGA
TRN  10010101110011000
NAM  BLM_HUMAN/1212-1292
ASQ  EEMVKKCLGELTEVCKSLGKVFGVH.YFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQ.KYSEWTSPA
DSQ  GAAGAGATGGTTAAAAAATGTCTTGGAGAACTTACAGAAGTCTGCAAATCTCTGGGGAAAGTTTTTGGTGTCCAT...TACTTCAATATTTTTAATACCGTCACTCTCAAGAAGCTTGCAGAATCTTTATCTTCTGATCCTGAGGTTTTGCTTCAAATTGATGGTGTTACTGAAGACAAACTGGAAAAATATGGTGCGGAAGTGATTTCAGTATTACAG...AAATACTCTGAATGGACATCGCCAGCT
TRN  11011101101011000
//