EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00508 - PPV_E2_N)
FAM  PF00508
PID  PPV_E2_N
DES  E2 (early) protein, N terminal
IPR  IPR001866
ANO  24
ALN  206
AID  0.445078
APH  (VE2_PAPVD/1-202:0.28200,(VE2_BPV1/1-202:0.26831,((((VE2_HPV63/1-203:0.18920,VE2_HPV1A/1-203:0.18694):0.23043,VE2_CRPVK/1-203:0.52194):0.09750,VE2_HPV41/4-206:0.68385):0.02792,(((((VE2_HPV34/2-202:0.37915,((VE2_HPV51/1-200:0.25529,VE2_HPV26/1-201:0.25676):0.20761,VE2_HPV30/1-201:0.35614):0.11486):0.08158,((VE2_HPV52/1-201:0.17630,VE2_HPV33/1-201:0.25927):0.13471,(VE2_HPV35/2-202:0.19635,VE2_HPV16/1-201:0.20799):0.11856):0.13935):0.09963,(VE2_HPV32/1-202:0.31333,(VE2_HPV11/1-201:0.30115,VE2_HPV07/1-201:0.31463):0.06648):0.07772):0.07133,(VE2_HPV27/1-203:0.30569,VE2_HPV03/1-203:0.34523):0.16703):0.22067,(VE2_HPV04/1-203:0.55333,((VE2_HPV49/1-202:0.24116,VE2_HPV09/1-202:0.26788):0.08345,VE2_HPV05/1-202:0.32726):0.15327):0.14239):0.09091):0.43709):0.25496,VE2_PAPVE/3-205:0.30249);
ATP  (VE2_PAPVD/1-202,(VE2_BPV1/1-202,((((VE2_HPV63/1-203,VE2_HPV1A/1-203),VE2_CRPVK/1-203),VE2_HPV41/4-206),(((((VE2_HPV34/2-202,((VE2_HPV51/1-200,VE2_HPV26/1-201),VE2_HPV30/1-201)),((VE2_HPV52/1-201,VE2_HPV33/1-201),(VE2_HPV35/2-202,VE2_HPV16/1-201))),(VE2_HPV32/1-202,(VE2_HPV11/1-201,VE2_HPV07/1-201))),(VE2_HPV27/1-203,VE2_HPV03/1-203)),(VE2_HPV04/1-203,((VE2_HPV49/1-202,VE2_HPV09/1-202),VE2_HPV05/1-202))))),VE2_PAPVE/3-205);
ATL  10.5091
DNO  19
DLN  618
DID  0.533737
DPH  (((((((VE2_HPV07/1-201:0.26217,VE2_HPV11/1-201:0.23201):0.06625,VE2_HPV32/1-202:0.26651):0.05051,(((VE2_HPV30/1-201:0.23665,VE2_HPV26/1-201:0.26574):0.07241,VE2_HPV34/2-202:0.27256):0.05775,(VE2_HPV16/1-201:0.22139,(VE2_HPV33/1-201:0.15810,VE2_HPV52/1-201:0.15852):0.08505):0.06695):0.06650):0.06467,(VE2_HPV03/1-203:0.23654,VE2_HPV27/1-203:0.28170):0.13825):0.13534,(VE2_HPV04/1-203:0.36644,(VE2_HPV49/1-202:0.16402,(VE2_HPV09/1-202:0.21865,VE2_HPV05/1-202:0.31037):0.06990):0.11550):0.11276):0.07806,(VE2_HPV41/4-206:0.45735,VE2_HPV63/1-203:0.32609):0.06474):0.38792,VE2_PAPVD/1-202:0.19415,VE2_PAPVE/3-205:0.24025);
DTP  (((((((VE2_HPV07/1-201,VE2_HPV11/1-201),VE2_HPV32/1-202),(((VE2_HPV30/1-201,VE2_HPV26/1-201),VE2_HPV34/2-202),(VE2_HPV16/1-201,(VE2_HPV33/1-201,VE2_HPV52/1-201)))),(VE2_HPV03/1-203,VE2_HPV27/1-203)),(VE2_HPV04/1-203,(VE2_HPV49/1-202,(VE2_HPV09/1-202,VE2_HPV05/1-202)))),(VE2_HPV41/4-206,VE2_HPV63/1-203)),VE2_PAPVD/1-202,VE2_PAPVE/3-205);
DTL  6.50177
RID  0.445994
RPH  (VE2_PAPVD/1-202:0.25504,((VE2_HPV04/1-203:0.50969,((VE2_HPV49/1-202:0.24789,VE2_HPV09/1-202:0.26102):0.09122,VE2_HPV05/1-202:0.31361):0.18542):0.12492,((((((VE2_HPV52/1-201:0.18570,VE2_HPV33/1-201:0.24469):0.12679,VE2_HPV16/1-201:0.29222):0.14270,((VE2_HPV26/1-201:0.40779,VE2_HPV30/1-201:0.34920):0.11635,VE2_HPV34/2-202:0.38197):0.08536):0.09899,(VE2_HPV32/1-202:0.30900,(VE2_HPV11/1-201:0.30000,VE2_HPV07/1-201:0.31199):0.05977):0.07949):0.09582,(VE2_HPV27/1-203:0.31648,VE2_HPV03/1-203:0.33200):0.12739):0.20791,(VE2_HPV63/1-203:0.41633,VE2_HPV41/4-206:0.67026):0.08767):0.08858):0.62608,VE2_PAPVE/3-205:0.32042);
RTP  (VE2_PAPVD/1-202,((VE2_HPV04/1-203,((VE2_HPV49/1-202,VE2_HPV09/1-202),VE2_HPV05/1-202)),((((((VE2_HPV52/1-201,VE2_HPV33/1-201),VE2_HPV16/1-201),((VE2_HPV26/1-201,VE2_HPV30/1-201),VE2_HPV34/2-202)),(VE2_HPV32/1-202,(VE2_HPV11/1-201,VE2_HPV07/1-201))),(VE2_HPV27/1-203,VE2_HPV03/1-203)),(VE2_HPV63/1-203,VE2_HPV41/4-206))),VE2_PAPVE/3-205);
RTL  8.76976
LNK  VE2_BPV1/1-202:P03122:
LNK  VE2_CRPVK/1-203:P03121:
LNK  VE2_HPV03/1-203:P36778:X74462
LNK  VE2_HPV04/1-203:Q07849:X70827
LNK  VE2_HPV05/1-202:P06921:M17463
LNK  VE2_HPV07/1-201:P36779:X74463
LNK  VE2_HPV09/1-202:P36780:X74464
LNK  VE2_HPV11/1-201:P04015:M14119
LNK  VE2_HPV16/1-201:P03120:K02718
LNK  VE2_HPV1A/1-203:P03118:
LNK  VE2_HPV26/1-201:P36788:X74472
LNK  VE2_HPV27/1-203:P36789:X74473
LNK  VE2_HPV30/1-201:P36790:X74474
LNK  VE2_HPV32/1-202:P36791:X74475
LNK  VE2_HPV33/1-201:P06423:M12732
LNK  VE2_HPV34/2-202:P36792:X74476
LNK  VE2_HPV35/2-202:P27222:
LNK  VE2_HPV41/4-206:P27552:X56147
LNK  VE2_HPV49/1-202:P36795:X74480
LNK  VE2_HPV51/1-200:P26547:
LNK  VE2_HPV52/1-201:P36796:X74481
LNK  VE2_HPV63/1-203:Q07850:X70828
LNK  VE2_PAPVD/1-202:P03123:M11910
LNK  VE2_PAPVE/3-205:P11329:M15953
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VE2_PAPVE/3-205
ASQ  MSAASDHLLAAQETQMQCIEKDSRLLQDHACYWGAVRREKLLLYAARTKGLKTIGCVPVPPCSVTAEQAKQAICMQLIVEELLHSPWAKEPWSLTDLSWERYQAAPKGCLKKGARVVEVEYDGNSSNKTWYTAWSTVYVRGTEEEGWETAVCAADGQGIYYCAGMSS.KVYFETFETDARRWSR-TGHWTVRDN-DVIYHSTFGAP
DSQ  ATGAGTGCAGCCAGCGATCATTTACTTGCAGCGCAAGAAACACAGATGCAATGCATTGAGAAAGATAGTCGCCTGTTACAGGATCATGCATGCTATTGGGGGGCAGTAAGAAGGGAAAAACTGTTATTATATGCAGCGAGAACAAAGGGGTTAAAAACAATTGGGTGTGTGCCTGTGCCTCCTTGTTCTGTTACTGCAGAGCAAGCGAAGCAAGCAATATGCATGCAATTGATTGTGGAGGAATTACTGCACAGTCCATGGGCCAAAGAACCATGGTCCCTTACAGACCTAAGCTGGGAGAGATATCAGGCTGCCCCAAAAGGGTGTTTGAAAAAAGGCGCCAGAGTGGTGGAAGTGGAGTATGATGGGAACTCTTCTAATAAGACTTGGTATACAGCTTGGAGTACAGTGTACGTGCGCGGAACGGAAGAGGAGGGCTGGGAGACTGCTGTCTGTGCTGCAGACGGACAGGGCATTTATTATTGCGCCGGGATGAGCAGT...AAGGTGTACTTTGAAACCTTTGAAACTGATGCCCGCAGATGGAGCAGG---ACGGGGCACTGGACTGTGAGGGATAAC---GATGTGATATATCATTCAACCTTTGGTGCACCC
TRN  10010101100011000
NAM  VE2_PAPVD/1-202
ASQ  MSAAKEQLLAAQETQMTLIEKDSTDLKDHIDSWGPVRREHGLLYAARHKGLIWLGLNPVPPCSVKCLEARQAIEMQLLGNSLKESPWCNEPWSLCDLSWGRYQAPPAETLKKGARLVEVEYDGSSTNKTWYTAWNSLYLRKPDEEGWETATGGADADGLFYTTMSGT.RVYYELFERDAARYST-TGTWTVRDN-DRTYHSHS-AP
DSQ  ATGAGTGCAGCCAAAGAACAGTTACTTGCAGCGCAAGAAACGCAAATGACATTAATTGAAAAAGATAGCACAGATTTGAAAGATCACATAGACTCTTGGGGTCCGGTCAGGAGAGAGCATGGTTTGCTTTATGCTGCCAGACACAAAGGCTTGATTTGGCTCGGTTTGAACCCTGTGCCACCATGCTCTGTGAAGTGCTTAGAAGCTCGGCAAGCAATTGAGATGCAGCTTCTGGGGAACAGCTTAAAGGAGAGCCCATGGTGCAATGAGCCATGGTCACTGTGTGACTTAAGCTGGGGACGCTATCAAGCGCCTCCAGCAGAAACTTTGAAAAAAGGCGCCAGACTGGTTGAAGTGGAGTATGATGGGAGCTCCACTAATAAAACTTGGTATACCGCTTGGAATTCATTGTACTTGCGCAAACCGGATGAGGAGGGCTGGGAGACGGCGACTGGTGGTGCAGACGCAGACGGTCTCTTCTATACTACCATGTCCGGTACA...CGGGTTTATTATGAGCTCTTTGAAAGAGATGCAGCCAGATACAGCACT---ACAGGGACTTGGACTGTGAGGGATAAC---GATCGTACTTATCACTCACATTCT---GCGCCC
TRN  10010101100011000
NAM  VE2_BPV1/1-202
ASQ  METACERLHVAQETQMQLIEKSSDKLQDHILYWTAVRTENTLLYAARKKGVTVLGHCRVPHSVVCQERAKQAIEMQLSLQELSKTEFGDEPWSLLDTSWDRYMSEPKRCFKKGARVVEVEFDGNASNTNWYTVYSNLYMR--TEDGWQLAKAGADGTGLYYCTMAGAgRIYYSRFGDEAARFST-TGHYSVRDQ-DRVYAGVSSTS
NAM  VE2_HPV63/1-203
ASQ  MESLNNRLDWLQEQLLTLYEKDSKDIEDQIMQWNLLRQEQVLFHYARKKGIMRLGLQVVPSLAASQDKAKTAIEMTLYLSGLRDSQYGSEQWSLQDTSREIFLAPPDHTFKKGGQTIEVIYDEDPNNSTRHTVWRHIYYQN-GDNRWRKAASDVDVHGVFYLEYDGV.KNYYVDFQEEANRYSK-TGRYTVQYEGKRFTNVMSPVN
DSQ  ATGGAAAGCCTCAACAACCGCTTAGACTGGCTACAAGAGCAGCTTCTAACTCTATATGAGAAAGACAGTAAAGATATTGAAGATCAGATAATGCAGTGGAATCTACTTAGACAGGAACAAGTGTTATTCCACTATGCCCGAAAAAAGGGAATAATGCGACTTGGCCTGCAAGTTGTGCCTTCCCTTGCAGCTTCCCAGGATAAAGCAAAAACAGCTATAGAAATGACTCTTTATCTTAGTGGCCTCAGAGACTCACAATATGGTTCTGAACAGTGGTCTTTACAAGATACTAGCAGAGAAATCTTTTTAGCACCACCAGATCATACATTCAAAAAGGGAGGGCAAACAATTGAGGTAATCTATGATGAGGATCCCAATAATAGCACCAGACATACTGTATGGCGCCATATATATTATCAAAAC---GGTGATAACAGATGGAGAAAAGCAGCTAGTGATGTAGATGTTCATGGTGTGTTTTATTTAGAATATGATGGTGTC...AAAAACTACTATGTTGACTTTCAAGAAGAGGCCAATCGATATAGCAAA---ACAGGTCGATATACTGTTCAATATGAGGGTAAAAGGTTCACAAATGTTATGTCTCCTGTCAAT
TRN  10010101100011000
NAM  VE2_HPV1A/1-203
ASQ  MENLSSRLDLLQEQLMNLYEQDSKLIEDQIKQWNLIRQEQVLFHFARKNGVMRIGLQAVPSLASSQEKAKTAIEMVLHLESLKDSPYGTEDWSLQDTSRELFLAPPAGTFKKSGSTLEVTYDNNPDNQTRHTIWNHVYYQN-GDDVWRKVSSGVDAVGVYYLEHDGY.KNYYVLFAEEASKYST-TGQYAVNYRGKRFTNVMSSTS
NAM  VE2_CRPVK/1-203
ASQ  MEALSQRLDSIQEELLSLYEKESTSLESQLQHWNLLRKEQVLLHFCKKHGIRQLGYTPVPSLLTSQECAKQAIEMVLYIESLLRSPYSDEPWTLQDTSRERFESPPQKTFKKNPAIVEVYYDGDRGNNNEYTLWGIFIIGN-ADGEWVKTESGVDYRGIYYVDSEGN.YVYYVDFSTDAGRFAA-NGHYDVVFQNMRLSSSVTSSP
NAM  VE2_HPV49/1-202
ASQ  MEALNARFNVLQEMLMDIYESGKEDLETQIEHWKLLRQEQALLFFARKHSIMRLGYQPVPPMAVSETKAKQAIGMMLTLQSLQKSPFGKEKWTLVNTSLETYNAPPAQCFKKGPYNIEVIFDGDPENLMVYTAWKEIYFVD-SDDMWQKVQGEVDYAGAYYKDGT-I.KQYYVTFADDAVRYGT-SGQYEVRINNETVFAPVTSST
DSQ  ATGGAGGCACTCAACGCTCGTTTCAATGTACTACAAGAGATGTTAATGGACATTTATGAATCAGGGAAAGAGGATCTTGAAACACAAATAGAACATTGGAAACTGTTAAGACAGGAACAAGCTTTATTATTTTTTGCACGTAAACACAGCATAATGAGACTGGGGTATCAACCCGTACCTCCGATGGCAGTATCTGAAACCAAAGCCAAACAAGCTATTGGCATGATGCTAACTTTGCAAAGCTTGCAAAAGTCTCCTTTTGGAAAAGAAAAGTGGACTTTAGTAAACACAAGTCTTGAAACATACAATGCACCACCAGCACAGTGCTTTAAAAAAGGTCCTTATAATATAGAAGTTATATTTGATGGAGATCCTGAAAATCTAATGGTATATACTGCTTGGAAAGAGATTTATTTTGTAGAC---TCAGATGATATGTGGCAAAAGGTGCAAGGTGAGGTGGATTATGCAGGTGCATATTATAAGGATGGAACT---ATC...AAACAGTATTATGTTACCTTCGCTGATGATGCTGTTAGATATGGGACA---TCTGGACAATATGAAGTCCGCATTAACAACGAAACTGTGTTTGCTCCTGTTACTAGCTCCACC
TRN  10010101100011000
NAM  VE2_HPV09/1-202
ASQ  METLSARFNALQETLMDLYESGREDLQSQIDHWQTLRQEQILLHYARKNGVMRLGYQPVPPLATSEQKAKDAIGMVLLLQSLQRSAYGQEPWTLAQTSLEAVRSPPAYAFKKGPQNIEVVYDGDPDNVMSYTIWNFIYYQT-VNDTWEKVQGHVDYFGAYYFEGT-V.KTYYINFDKDAARYGR-TGVWEVHVNKDIVFAPVTSSS
DSQ  ATGGAAACTCTCAGCGCACGTTTCAATGCACTGCAAGAGACTTTAATGGACCTGTATGAATCAGGTCGAGAGGATCTACAAAGTCAGATTGACCACTGGCAGACTTTAAGACAAGAGCAAATACTTTTGCATTATGCCAGGAAAAATGGAGTTATGCGATTGGGGTACCAACCTGTACCTCCGTTGGCTACCAGTGAACAGAAAGCTAAAGATGCTATTGGCATGGTTTTACTATTGCAAAGCCTTCAAAGATCAGCTTATGGACAGGAACCTTGGACACTGGCACAAACTAGTCTTGAGGCGGTACGCAGTCCACCTGCATATGCCTTTAAAAAGGGTCCACAAAATATTGAAGTAGTTTATGATGGAGATCCTGATAATGTTATGAGCTATACTATATGGAACTTTATATATTATCAGACT---GTTAATGATACTTGGGAAAAAGTTCAAGGTCACGTGGATTATTTTGGAGCCTATTACTTTGAAGGGACT---GTA...AAAACATATTATATTAACTTTGACAAAGATGCAGCCAGGTATGGCAGA---ACTGGCGTTTGGGAAGTGCATGTTAACAAGGACATTGTGTTTGCCCCTGTTACTAGCTCTTCG
TRN  10010101100011000
NAM  VE2_HPV05/1-202
ASQ  MENLSERFNALQDQLMNIYEAAEQTLQAQIKHWQTLRKEPVLLYYAREKGVTRLGYQPVPVKAVSETKAKEAIAMVLQLESLQTSDFAHEPWTLVDTSIETFRSAPEGHFKKGPLPVEVIYDNDPDNANLYTMWTYVYYMD-ADDKWHKARSGVNHIGIYYLQGT-F.KNYYVLFADDAKRYGT-TGEWEVKVNKETVFAPVTSST
DSQ  ATGGAGAATCTCAGCGAGCGTTTCAATGCTCTGCAAGATCAGCTAATGAACATTTATGAAGCTGCAGAACAAACATTGCAGGCACAAATTAAACATTGGCAAACCTTACGAAAAGAACCTGTATTACTCTACTATGCTAGGGAGAAAGGTGTTACAAGGCTTGGATATCAACCTGTGCCTGTAAAGGCAGTATCAGAAACAAAGGCTAAAGAAGCCATAGCAATGGTGCTGCAGCTTGAGTCACTACAGACATCTGATTTTGCTCATGAGCCATGGACTCTAGTTGATACCAGCATAGAAACATTTAGAAGCGCTCCAGAAGGTCACTTCAAAAAAGGCCCCCTCCCTGTAGAAGTTATTTATGACAATGATCCAGATAATGCCAATTTGTATACAATGTGGACCTATGTGTATTATATGGAT---GCGGATGATAAGTGGCATAAGGCAAGAAGTGGGGTGAATCACATTGGCATTTATTATTTACAAGGAACT---TTT...AAAAACTATTATGTACTGTTTGCTGACGATGCGAAAAGATATGGTACA---ACTGGAGAATGGGAAGTAAAAGTTAATAAGGAAACTGTGTTTGCTCCTGTCACCAGCTCCACG
TRN  10010101100011000
NAM  VE2_HPV04/1-203
ASQ  MESLVARFDALQEAILTHIESQESTLESQIQYWENIRKENAIMHYARKQGLTKLGLQPLPTLAVTEYNAKQAIQIHLTLQSLLKSPFASERWTLTDVSAELINTSPQNCLKKGGYDVAVWFDNDRQNAMLYTNWDFLYYQD-MNEQWHKVKGEVDYDGLYFTDHTGE.RAYFTLFSSDAQRFSR-TGLWTVHFKTQVISSPIVSST
DSQ  ATGGAGTCCCTAGTCGCACGTTTCGATGCACTTCAAGAAGCAATTCTGACTCATATTGAGTCACAGGAGAGCACTTTGGAATCCCAAATCCAATATTGGGAAAATATCAGAAAAGAAAATGCTATAATGCATTATGCTCGAAAACAAGGCCTAACCAAATTAGGTCTACAACCACTTCCTACACTAGCAGTAACTGAATACAATGCAAAGCAAGCTATTCAGATACATTTAACTTTGCAATCATTGTTAAAATCTCCCTTTGCATCTGAACGGTGGACATTGACAGATGTTAGTGCAGAACTGATAAATACCTCTCCACAAAACTGTTTAAAAAAGGGAGGTTATGATGTTGCTGTGTGGTTTGATAATGATAGACAGAATGCAATGCTGTACACAAATTGGGACTTTTTATATTATCAAGAT---ATGAATGAACAGTGGCACAAAGTTAAAGGTGAAGTGGATTATGATGGCTTATACTTTACAGACCATACGGGAGAA...AGAGCTTATTTTACATTATTTAGCTCTGATGCTCAAAGATTTAGCAGA---ACTGGACTGTGGACTGTGCATTTTAAAACCCAAGTTATTTCCTCCCCTATTGTTAGCTCTACA
TRN  10010101100011000
NAM  VE2_HPV52/1-201
ASQ  MESIPARLNAVQEKILDLYEADSNDLNAQIEHWKLTRMECVLFYKAKELGITHIGHQVVPPMAVSKAKACQAIELQLALEALNKTQYSTDGWTLQQTSLEMWRAEPQKYFKKHGYTITVQYDNDKNNTMDYTNWKEIYLLGECE--CTIVEGQVDYYGLYYWC-DGE.KIYFVKFSNDAKQYCV-TGVWEVHVGGQVIVCPASVSS
DSQ  ATGGAGTCGATACCGGCACGTTTAAATGCAGTGCAGGAAAAAATACTAGATCTATACGAAGCTGATAGTAATGACCTAAACGCACAAATTGAACATTGGAAATTGACTCGAATGGAATGTGTTTTGTTTTACAAAGCAAAGGAACTGGGAATAACTCATATAGGCCACCAGGTGGTGCCACCAATGGCAGTGTCTAAGGCAAAGGCCTGCCAAGCTATTGAACTACAATTGGCATTGGAGGCATTAAACAAAACACAATATAGCACAGATGGATGGACATTACAACAAACAAGTCTAGAAATGTGGCGTGCAGAACCACAAAAATACTTTAAAAAACATGGGTATACAATAACAGTGCAATACGATAATGATAAAAACAATACTATGGATTATACAAACTGGAAGGAAATTTATTTACTTGGTGAGTGTGAA------TGTACAATTGTAGAAGGACAAGTAGATTACTATGGGTTATATTATTGGTGT---GATGGAGAA...AAAATATATTTTGTAAAATTTAGTAACGATGCAAAGCAATATTGTGTA---ACAGGAGTATGGGAAGTACATGTGGGTGGTCAGGTAATTGTTTGTCCTGCATCTGTATCTAGT
TRN  10010101100011010
NAM  VE2_HPV33/1-201
ASQ  MEEISARLNAVQEKILDLYEADKTDLPSQIEHWKLIRMECALLYTAKQMGFSHLCHQVVPSLLASKTKAFQVIELQMALETLSKSQYSTSQWTLQQTSLEVWLCEPPKCFKKQGETVTVQYDNDKKNTMDYTNWGEIYIIEEDT--CTMVTGKVDYIGMYYIH-NCE.KVYFKYFKEDAAKYSK-TQMWEVHVGGQVIVCPTSISS
DSQ  ATGGAGGAAATATCAGCACGTTTAAATGCAGTGCAGGAGAAAATACTAGATCTTTACGAAGCTGATAAAACTGATTTACCATCACAAATTGAACATTGGAAACTGATACGCATGGAGTGTGCTTTATTGTATACAGCCAAACAAATGGGATTTTCACATTTATGCCACCAGGTGGTGCCTTCTTTGTTAGCATCAAAGACCAAAGCATTTCAAGTAATTGAACTACAAATGGCATTAGAGACATTAAGTAAATCACAGTATAGTACAAGCCAATGGACATTGCAACAAACAAGCTTAGAGGTGTGGCTTTGTGAACCACCAAAATGTTTTAAAAAACAAGGAGAAACAGTAACTGTGCAATATGACAATGACAAAAAAAATACAATGGATTATACAAACTGGGGTGAAATATATATTATAGAGGAAGATACA------TGTACTATGGTTACAGGGAAAGTAGATTATATAGGTATGTATTATATACAT---AACTGTGAA...AAGGTATATTTTAAATATTTTAAAGAGGATGCTGCAAAGTATTCTAAA---ACACAAATGTGGGAAGTACATGTGGGTGGTCAGGTAATTGTTTGTCCTACGTCTATATCTAGC
TRN  10010101100011000
NAM  VE2_HPV35/2-202
ASQ  METLSQRLSVCQDKILEHYETDSTCLSDHIQYWKLIRLECAVFYKAREMGIKTLNHQVVPTQAISKAKAMQAIELQLMLETLNTTEYSTETWTLQETSIELYTTVPQGCFKKHGVTVEVQFDGDKQNTMHYTNWTHIYILEDSI--CTVVKGLVNYKGIYYVH-QGV.ETYYVTFREEAKKYGK-KNIWEVHVGGQVIVCPESVFS
NAM  VE2_HPV16/1-201
ASQ  METLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDICNTMHYTNWTHIYICEEAS--VTVVEGQVDYYGLYYVH-EGI.RTYFVQFKDDAEKYSK-NKVWEVHAGGQVILCPTSVFS
DSQ  ATGGAGACTCTTTGCCAACGTTTAAATGTGTGTCAGGACAAAATACTAACACATTATGAAAATGATAGTACAGACCTACGTGACCATATAGACTATTGGAAACACATGCGCCTAGAATGTGCTATTTATTACAAGGCCAGAGAAATGGGATTTAAACATATTAACCACCAAGTGGTGCCAACACTGGCTGTATCAAAGAATAAAGCATTACAAGCAATTGAACTGCAACTAACGTTAGAAACAATATATAACTCACAATATAGTAATGAAAAGTGGACATTACAAGACGTTAGCCTTGAAGTGTATTTAACTGCACCAACAGGATGTATAAAAAAACATGGATATACAGTGGAAGTGCAGTTTGATGGAGACATATGCAATACAATGCATTATACAAACTGGACACATATATATATTTGTGAAGAAGCATCA------GTAACTGTGGTAGAGGGTCAAGTTGACTATTATGGTTTATATTATGTTCAT---GAAGGAATA...CGAACATATTTTGTGCAGTTTAAAGATGATGCAGAAAAATATAGTAAA---AATAAAGTATGGGAAGTTCATGCGGGTGGTCAGGTAATATTATGTCCTACATCTGTGTTTAGC
TRN  10010101100011000
NAM  VE2_HPV51/1-200
ASQ  METLCHRLNVCQEKILDCYELDSDKLVDQINYWTLLRYEAAMFYAARERNLRTINHQVVPATTVSKQKACQAIEMHMALQSLNKSDYNMEPWTMRETCYELWCVAPKQCFKKGGITVTVIFDGNKDNAMDYTSWKFIYIYDNDK--WVKTNGNVDYTGIYYTV-NSK.KEYYVQFKDEAKIYG--AQQWEVYMYGTVITCPEYVSS
NAM  VE2_HPV26/1-201
ASQ  MENLCQRLNACQEKILDYYELDSNKLTDQIDYWKLVRYECAIFYKAREGNMQCINHQVVPSTVVCKQKAWQAIEIHIALQSLINTDYNTEAWTMRDTSYEMYMTEPKHCFKKEGTTVTVVFDCNKENTMDYIRWKYVYYKTDIG--WCKGTGDVDAKGIYYTQ-GAY.KQYYVDFKQEAEKYGT-GVQWAVHVCGQVICCPEFVSS
DSQ  ATGGAGAACCTTTGCCAGCGTTTAAATGCGTGCCAGGAGAAAATACTAGACTATTATGAACTGGACAGTAATAAATTAACTGATCAAATTGATTATTGGAAACTGGTACGATATGAATGTGCAATATTTTATAAAGCTCGTGAAGGAAACATGCAATGTATAAACCACCAGGTGGTGCCCTCTACTGTTGTGTGTAAACAAAAGGCATGGCAGGCAATTGAAATACATATAGCATTGCAGTCGTTAATAAACACGGACTATAATACAGAAGCTTGGACAATGCGAGACACAAGCTATGAAATGTATATGACAGAACCTAAACATTGTTTTAAAAAAGAAGGAACAACGGTAACAGTGGTATTTGATTGTAATAAGGAAAATACAATGGATTATATTAGGTGGAAATATGTGTATTATAAAACTGATATAGGG------TGGTGTAAAGGTACTGGAGATGTTGATGCAAAAGGGATATATTATACACAA---GGGGCATAT...AAGCAGTATTACGTGGACTTTAAACAAGAGGCGGAAAAATATGGGACA---GGTGTGCAATGGGCTGTACATGTGTGTGGTCAGGTAATCTGTTGTCCTGAATTTGTATCTAGT
TRN  10010101100011010
NAM  VE2_HPV34/2-202
ASQ  METLCKRLSACQDAILELYERDSIHLSDHIDHWKHVRLENVLLHKAREMGLQSVNQQAVPSLAVSRSKGHNAIELQLALESLNESSYNTEEWTLQQTSWEQWVTDPKQCFKKGGKTVEVRYDCDKDNTMQYVVWTFVYYWLEGK--WYKVSSHVDYNGIYYETQDNE.KVYYTQFDRDAKRYG-VKGIWDVCMGG-KVICFAPVFS
DSQ  ATGGAGACACTGTGCAAACGTTTAAGTGCGTGTCAGGACGCAATCCTAGAACTGTATGAACGTGATAGTATACATTTAAGTGATCATATTGATCACTGGAAACACGTGCGACTGGAAAATGTATTATTACATAAGGCACGTGAAATGGGACTGCAATCAGTTAACCAACAAGCGGTGCCAAGCCTTGCAGTATCACGATCCAAAGGGCATAATGCAATTGAACTACAATTAGCCCTAGAAAGTTTAAATGAATCAAGCTATAACACAGAAGAATGGACATTACAACAGACAAGTTGGGAACAGTGGGTAACGGACCCAAAACAATGTTTTAAAAAAGGTGGAAAAACAGTAGAAGTTAGATATGACTGTGACAAGGACAACACCATGCAATATGTGGTATGGACATTTGTGTATTATTGGTTGGAAGGCAAG------TGGTATAAAGTGAGTAGCCATGTAGATTATAATGGTATATATTATGAAACACAGGACAATGAA...AAGGTATATTATACACAATTTGACAGAGATGCAAAACGATATGGG---GTTAAAGGAATATGGGATGTATGTATGGGCGGT---AAGGTAATATGTTTTGCTCCTGTATTTAGC
TRN  10010101100011000
NAM  VE2_HPV30/1-201
ASQ  METLCQRLDACQEKILDCFENDSKKIEDHIVYWKAVRHENVVLYKARQNNITKLRHQVVPCLQVCKAKACVAIEIQMALESLYKTEYKVEEWTLKDVCENMWHTAPKQCFKKSGKRIEVWFDGKKDNRTEYVVWQWVYYCGDNG--WTKVPSVVDYKGIYYVH-DGN.KVYYTDFNDEAVKYGY-KGTWEVHMGNESIYCPDSVSS
DSQ  ATGGAGACTCTATGCCAACGTTTAGATGCGTGCCAGGAGAAAATTCTAGACTGTTTTGAAAACGATAGTAAAAAAATTGAAGACCATATAGTGTACTGGAAAGCTGTACGACATGAAAATGTTGTATTATATAAAGCAAGACAAAATAATATTACTAAACTACGCCACCAGGTGGTGCCATGTTTACAAGTGTGTAAAGCAAAGGCATGTGTTGCTATAGAAATACAAATGGCATTGGAATCATTATATAAAACAGAGTATAAAGTGGAGGAGTGGACATTAAAAGATGTATGTGAAAATATGTGGCATACAGCACCAAAACAGTGTTTTAAAAAAAGTGGAAAACGTATAGAAGTGTGGTTTGATGGGAAAAAAGACAATCGAACTGAATATGTTGTGTGGCAATGGGTGTATTACTGTGGGGACAATGGG------TGGACTAAAGTGCCTTCTGTAGTAGATTACAAAGGTATATATTATGTACAT---GACGGTAAC...AAAGTATATTATACAGACTTTAATGACGAGGCAGTAAAGTATGGGTAT---AAAGGCACATGGGAAGTGCATATGGGAAATGAAAGTATTTATTGTCCCGACTCTGTGTCTAGT
TRN  10010101110011000
NAM  VE2_HPV32/1-202
ASQ  METLAKRLDACQEQLLELYEEDSKHLEKHVQHWKCLRIEAALLFKAREMGYAQVGHQIVPALEISRAKAHVAIEIQLALETLLQSTFGTEPWTLQETSYEMWHAEPKKCLKKQGRTVEVVFDGNPENAMHYTAWTFIYVQTLDGT-WCKVYGHVCYAGLYYIV-DNM.KQFYCNFKNEAKKYGV-TGQWEVHDGTQVIVSPASISS
DSQ  ATGGAGACACTGGCCAAACGTTTAGATGCGTGCCAGGAACAGTTGTTAGAACTGTATGAGGAAGATAGTAAACATTTAGAAAAACATGTGCAGCACTGGAAGTGTTTACGCATAGAAGCAGCCTTATTATTTAAGGCTCGTGAAATGGGCTATGCACAAGTAGGACATCAAATAGTGCCAGCACTGGAAATATCCAGGGCCAAGGCCCACGTTGCAATTGAAATTCAATTGGCGTTAGAGACATTATTGCAGTCCACATTTGGTACAGAACCATGGACATTGCAAGAGACAAGTTATGAAATGTGGCATGCGGAGCCCAAAAAGTGTTTAAAAAAACAGGGACGCACTGTGGAGGTTGTATTCGATGGAAATCCTGAGAATGCAATGCATTATACAGCATGGACATTTATATACGTGCAAACACTAGATGGCACA---TGGTGTAAAGTATACGGACACGTATGCTATGCAGGACTATACTACATTGTG---GACAACATG...AAACAGTTTTATTGTAACTTTAAAAATGAGGCAAAAAAATATGGGGTA---ACCGGACAATGGGAGGTACATGATGGCACTCAGGTGATTGTTTCTCCTGCATCCATATCTAGC
TRN  10010101100011010
NAM  VE2_HPV11/1-201
ASQ  MEAIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVPPLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVKFDGCEDNVMEYVVWTHIYLQDND-S-WVKVTSSVDAKGIYYTC-GQF.KTYYVNFNKEAQKYGS-TNHWEVCYGSTVICSPASVSS
DSQ  ATGGAAGCAATAGCCAAGCGTTTAGATGCGTGCCAGGATCAGTTGTTAGAACTTTATGAAGAAAACAGTATTGATATACACAAACACATTATGCATTGGAAATGCATACGATTGGAAAGTGTATTACTACACAAAGCAAAACAAATGGGCCTGAGCCACATCGGGTTACAAGTAGTACCACCATTAACTGTGTCAGAGACTAAAGGACATAATGCTATTGAAATGCAAATGCATTTAGAATCCTTAGCAAAAACTCAGTATGGTGTGGAACCTTGGACATTACAGGACACCAGTTATGAAATGTGGCTAACACCACCCAAACGGTGCTTTAAAAAACAGGGAAATACTGTGGAGGTAAAATTTGATGGCTGTGAAGACAATGTAATGGAGTATGTGGTATGGACACATATATACCTGCAGGACAACGAC---TCA---TGGGTAAAAGTAACTAGTTCCGTAGATGCCAAGGGCATATATTATACATGT---GGACAATTT...AAAACATATTATGTAAATTTTAATAAAGAGGCACAAAAGTATGGTAGT---ACCAATCATTGGGAAGTATGTTATGGCAGCACAGTTATATGTTCTCCTGCATCTGTATCTAGC
TRN  10010101100011000
NAM  VE2_HPV07/1-201
ASQ  MEKLARRLDLCQEQLLELYEQDSKQLQHHILHWKYIRYESVIYYTARQMGIKRLGHQVVPSLDVSKAKAHAAIEMQMCLESLQTTEYNLEPWTLQDTSQELWLAEPKKCFKKGGKTVEVRFDCNEHNAMHYTLWTAVYVQVED-T-WTKVEGQVDHRGLFYTV-HGC.TTYYVDFGKEAHTYGK-TNDWTVIVGSRVICSPSTVEG
DSQ  ATGGAGAAACTAGCCAGGCGCCTAGATTTGTGCCAGGAACAGTTGTTAGAACTTTATGAACAAGACAGCAAACAGCTACAGCACCATATATTGCACTGGAAATATATACGTTATGAAAGTGTAATATATTATACAGCAAGACAAATGGGCATTAAACGTCTGGGCCACCAGGTGGTGCCAAGTTTAGATGTGTCAAAAGCCAAAGCCCATGCAGCAATTGAAATGCAAATGTGTCTAGAATCTTTGCAAACTACTGAATATAACTTAGAGCCATGGACGTTACAGGACACAAGTCAAGAACTATGGCTTGCAGAACCAAAGAAATGTTTTAAAAAAGGAGGAAAGACAGTAGAAGTTAGATTTGACTGTAATGAACATAATGCAATGCATTATACTCTATGGACTGCAGTATATGTACAGGTGGAGGAT---ACA---TGGACAAAGGTTGAAGGCCAGGTGGACCACAGAGGCCTATTTTATACAGTG---CATGGGTGC...ACAACATATTATGTAGACTTTGGAAAGGAAGCACATACATATGGGAAA---ACAAATGACTGGACTGTTATTGTGGGTTCACGCGTTATATGTTCTCCTAGTACTGTCGAAGGG
TRN  10010101100011000
NAM  VE2_HPV27/1-203
ASQ  METLANRLDACQETLLELYEKDSNKLEDQIKHWAQVRLENVMLFKARECGMTRVGCTTVPALTVSKAKACQAIEVQLALQTLMQSAYSTEAWTLRDTCLEMWDAPPKKCWKKKGLSVLVKFDGSSDRDMIYTGWHHIYVQDANDDTWHKVPGKVDELGLYYEH-DGV.RVNYVDFGTESLTYG-VTGTWEVHVAGRVIHHTSASVS
DSQ  ATGGAAACACTAGCGAACCGTTTAGATGCGTGCCAGGAGACGTTGCTAGAACTTTATGAAAAAGATAGCAACAAACTTGAGGATCAGATTAAGCATTGGGCGCAGGTTCGGCTAGAAAATGTCATGCTGTTTAAGGCCCGGGAATGTGGAATGACACGAGTCGGCTGTACAACAGTGCCCGCCCTCACCGTGTCAAAGGCTAAGGCATGTCAGGCCATAGAGGTACAGCTGGCATTACAGACATTGATGCAGAGTGCCTATAGCACGGAGGCATGGACCTTACGAGACACGTGTCTGGAGATGTGGGATGCACCTCCAAAGAAATGCTGGAAAAAGAAAGGACTGTCAGTATTAGTGAAATTTGATGGCAGCAGTGACAGAGACATGATTTATACAGGCTGGCACCACATATATGTGCAGGATGCTAACGATGACACCTGGCACAAGGTTCCAGGGAAGGTGGACGAACTGGGATTATATTATGAGCAC---GATGGTGTG...CGTGTTAATTATGTGGACTTTGGAACTGAGTCCTTGACCTATGGG---GTCACTGGGACGTGGGAGGTGCACGTGGCTGGACGTGTTATTCACCATACATCTGCATCTGTGTCT
TRN  10010101100011000
NAM  VE2_HPV03/1-203
ASQ  METLANRLDVCQDKILELYEKDSDKLEDQIMHWQLMRLEQALLYKARECGLTHIGHQVVPPLSVTKAKARSAIEVHVSLQQLQHSAHAQDPWTLRDTSREMWDTVPKKCWKKRGLTVEVRYDGDENKAMCYVQWREIIVQNYTDDNWVKVAGLVSHEGLYYMH-EGQ.KTFYVKFKDDARVYG-DTGTWDVHVGGKVIHHDSFDPV
DSQ  ATGGAAACACTAGCGAACCGTTTAGATGTGTGCCAGGACAAAATACTAGAACTGTATGAAAAGGATAGCGACAAACTTGAGGACCAAATAATGCATTGGCAATTGATGCGGTTAGAGCAAGCTTTGTTGTACAAAGCAAGGGAATGTGGATTAACACACATTGGCCACCAGGTGGTGCCACCTCTTAGTGTAACCAAAGCAAAGGCACGCAGTGCCATTGAAGTGCATGTATCTTTGCAACAATTACAGCACAGTGCACATGCACAAGACCCCTGGACACTGCGAGACACGTCACGGGAAATGTGGGACACAGTTCCCAAGAAGTGCTGGAAAAAAAGAGGTTTAACTGTGGAAGTCAGATATGATGGAGACGAAAACAAAGCAATGTGTTATGTACAATGGAGGGAAATAATTGTGCAGAACTATACAGATGATAACTGGGTGAAGGTGGCAGGACTGGTGTCTCATGAGGGTCTATATTACATGCAC---GAAGGACAG...AAAACTTTTTATGTAAAATTTAAAGATGATGCGCGCGTGTATGGG---GACACAGGAACATGGGACGTACATGTGGGAGGCAAAGTAATTCACCACGATTCATTTGACCCTGTA
TRN  10010101100011000
NAM  VE2_HPV41/4-206
ASQ  MERLLERLDYIQEQILTLYEKDSVDLEDHIRLWNLLRRENAIWYVLRQEGHARVGGRAVPAMTVSEANAKFAIEMQIKLESLKASPYAAEGWSLQETTKERYLAEPSRTFKKLGQPVTLMFDNDPENLTEVVLWKWVYYITPTDE-WYKARGGIDDTGIYYIDHESV.KMYYVRFDMEAENFSE-TGTVTYRLGSALVNVPEPVTV
DSQ  ATGGAGAGACTCCTGGAACGATTAGACTATATACAAGAGCAGATACTGACACTATATGAGAAAGATAGTGTTGACCTAGAGGATCATATAAGGCTATGGAATCTGCTAAGGAGGGAAAATGCAATCTGGTATGTACTCAGACAGGAAGGACACGCAAGGGTCGGCGGCAGAGCGGTGCCGGCAATGACGGTATCGGAAGCCAATGCCAAATTCGCAATAGAAATGCAGATAAAGCTAGAATCACTAAAGGCCAGTCCCTATGCGGCCGAGGGCTGGTCATTGCAAGAAACCACCAAGGAACGGTACTTGGCTGAACCGTCTCGGACATTTAAGAAATTAGGGCAGCCAGTTACCCTAATGTTTGACAATGATCCCGAAAACCTTACAGAAGTTGTATTGTGGAAATGGGTTTATTATATTACACCAACAGATGAA---TGGTATAAAGCTAGAGGTGGCATTGATGACACTGGTATATACTACATTGACCACGAGTCTGTT...AAAATGTACTATGTGAGATTTGACATGGAAGCGGAGAACTTTAGCGAG---ACAGGCACTGTCACCTACCGGCTAGGCAGCGCCCTGGTAAATGTACCTGAACCTGTAACTGTT
TRN  10010101100011000
//