EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00460 - Flg_bb_rod)
FAM  PF00460
PID  Flg_bb_rod
DES  Flagella basal body rod protein
IPR  IPR001444
ANO  16
ALN  32
AID  0.309747
APH  (((((((((FLGF_CAUCR/5-35:0.65214,FLGG_BACSU/5-35:0.12584):0.14816,FLGE_CAUCR/7-37:0.50391):0.09357,FLGG_CAUCR/4-34:0.29435):0.06409,(FLGE_SALTY/2-32:0.44667,FLGG_SALTY/5-35:0.37362):0.02422):0.24715,(((FLGK_BACSU/8-38:0.35609,FLGK_SALTY/4-34:0.51744):0.26682,FLHP_BACSU/5-35:0.57440):0.05289,(FLGC_BACSU/7-37:0.24145,FLGC_SALTY/7-38:0.55658):0.37363):0.00000):0.09195,FLHO_BACSU/5-35:0.26073):0.21386,FLGF_SALTY/5-35:0.80949):0.17621,FLGB_BACSU/8-38:0.77520):0.46055,FLA1_BORBU/173-204:2.06470,FLGB_SALTY/8-38:0.09085);
ATP  (((((((((FLGF_CAUCR/5-35,FLGG_BACSU/5-35),FLGE_CAUCR/7-37),FLGG_CAUCR/4-34),(FLGE_SALTY/2-32,FLGG_SALTY/5-35)),(((FLGK_BACSU/8-38,FLGK_SALTY/4-34),FLHP_BACSU/5-35),(FLGC_BACSU/7-37,FLGC_SALTY/7-38))),FLHO_BACSU/5-35),FLGF_SALTY/5-35),FLGB_BACSU/8-38),FLA1_BORBU/173-204,FLGB_SALTY/8-38);
ATL  10.8937
DNO  16
DLN  96
DID  0.444892
DPH  (((FLHO_BACSU/5-35:0.29984,(FLA1_BORBU/173-204:1.16222,FLGC_BACSU/7-37:0.00000):0.39287):0.14227,(((FLGF_SALTY/5-35:0.53512,FLGC_SALTY/7-38:0.30480):0.12128,FLGK_BACSU/8-38:0.36384):0.13527,(((((FLGK_SALTY/4-34:0.47170,FLGE_SALTY/2-32:0.20972):0.06089,FLGG_BACSU/5-35:0.35841):0.09351,(FLGF_CAUCR/5-35:0.26245,(FLGE_CAUCR/7-37:0.22540,FLGG_CAUCR/4-34:0.19285):0.12098):0.09612):0.12464,FLGG_SALTY/5-35:0.17433):0.12432,FLHP_BACSU/5-35:0.54614):0.05483):0.04009):0.35501,FLGB_SALTY/8-38:0.50880,FLGB_BACSU/8-38:0.36539);
DTP  (((FLHO_BACSU/5-35,(FLA1_BORBU/173-204,FLGC_BACSU/7-37)),(((FLGF_SALTY/5-35,FLGC_SALTY/7-38),FLGK_BACSU/8-38),(((((FLGK_SALTY/4-34,FLGE_SALTY/2-32),FLGG_BACSU/5-35),(FLGF_CAUCR/5-35,(FLGE_CAUCR/7-37,FLGG_CAUCR/4-34))),FLGG_SALTY/5-35),FLHP_BACSU/5-35))),FLGB_SALTY/8-38,FLGB_BACSU/8-38);
DTL  7.65163
RID  0.309747
RPH  (((((((((FLGF_CAUCR/5-35:0.65214,FLGG_BACSU/5-35:0.12584):0.14816,FLGE_CAUCR/7-37:0.50391):0.09357,FLGG_CAUCR/4-34:0.29435):0.06409,(FLGE_SALTY/2-32:0.44667,FLGG_SALTY/5-35:0.37362):0.02422):0.24715,(((FLGK_BACSU/8-38:0.35609,FLGK_SALTY/4-34:0.51744):0.26682,FLHP_BACSU/5-35:0.57440):0.05289,(FLGC_BACSU/7-37:0.24145,FLGC_SALTY/7-38:0.55658):0.37363):0.00000):0.09195,FLHO_BACSU/5-35:0.26073):0.21386,FLGF_SALTY/5-35:0.80949):0.17621,FLGB_BACSU/8-38:0.77520):0.46055,FLA1_BORBU/173-204:2.06470,FLGB_SALTY/8-38:0.09085);
RTP  (((((((((FLGF_CAUCR/5-35,FLGG_BACSU/5-35),FLGE_CAUCR/7-37),FLGG_CAUCR/4-34),(FLGE_SALTY/2-32,FLGG_SALTY/5-35)),(((FLGK_BACSU/8-38,FLGK_SALTY/4-34),FLHP_BACSU/5-35),(FLGC_BACSU/7-37,FLGC_SALTY/7-38))),FLHO_BACSU/5-35),FLGF_SALTY/5-35),FLGB_BACSU/8-38),FLA1_BORBU/173-204,FLGB_SALTY/8-38);
RTL  10.8937
LNK  FLA1_BORBU/173-204:P11089:X15660
LNK  FLGB_BACSU/8-38:P24500:M54965
LNK  FLGB_SALTY/8-38:P16437:X52093
LNK  FLGC_BACSU/7-37:P24501:M54965
LNK  FLGC_SALTY/7-38:P16438:X52093
LNK  FLGE_CAUCR/7-37:P35806:AF072135
LNK  FLGE_SALTY/2-32:P16322:X51737
LNK  FLGF_CAUCR/5-35:Q06171:AE005880
LNK  FLGF_SALTY/5-35:P16323:X52094
LNK  FLGG_BACSU/5-35:P23446:X56049
LNK  FLGG_CAUCR/4-34:Q06172:S52478
LNK  FLGG_SALTY/5-35:P16439:X52094
LNK  FLGK_BACSU/8-38:P39810:U56901
LNK  FLGK_SALTY/4-34:P15932:X51738
LNK  FLHO_BACSU/5-35:P39752:U12962
LNK  FLHP_BACSU/5-35:P39753:Z83337
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  FLHP_BACSU/5-35
ASQ  MLTASTTLNQLQQQIDTISSNLSNSN-TTGYK
DSQ  ATGCTAACGGCATCAACAACCTTAAACCAGCTGCAGCAGCAGATTGACACAATCAGCAGCAACCTTTCAAACAGCAAC---ACAACCGGCTATAAG
TRN  11011111101111100
NAM  FLHO_BACSU/5-35
ASQ  LYTATSAMIAQQRRTEMLSNNIANAN-TSGYK
DSQ  TTATATACAGCAACATCCGCAATGATTGCCCAGCAGCGAAGAACGGAAATGCTTTCAAATAATATTGCTAACGCAAAT---ACATCAGGATATAAA
TRN  10010101110011000
NAM  FLGG_CAUCR/4-34
ASQ  LRTAASGMAAQQLNVEVISNNIANMN-TVGFK
DSQ  CTCCGCACCGCCGCTTCGGGTATGGCTGCTCAGCAGCTGAACGTCGAAGTCATCTCGAACAACATCGCCAACATGAAC---ACCGTTGGCTTCAAG
TRN  11011111101111111
NAM  FLGG_SALTY/5-35
ASQ  LWIAKTGLDAQQTNMDVIANNLANVS-TNGFK
DSQ  TTATGGATCGCCAAAACCGGTCTGGACGCGCAGCAAACCAATATGGATGTGATTGCCAATAACCTGGCAAACGTCAGC---ACCAATGGTTTTAAG
TRN  11011101101011010
NAM  FLGG_BACSU/5-35
ASQ  LYSGISGMKNFQTKLDVIGNNIANVN-TVGFK
DSQ  CTTTATTCTGGAATCAGCGGTATGAAAAACTTTCAAACAAAGCTTGACGTAATCGGTAACAACATTGCCAACGTAAAT---ACAGTAGGATTCAAA
TRN  11011101111011011
NAM  FLGE_SALTY/2-32
ASQ  FSQAVSGLNAAATNLDVIGNNIANSA-TYGFK
DSQ  TTTTCTCAAGCGGTTAGCGGCCTGAACGCTGCGGCCACCAACCTTGATGTTATCGGTAATAACATCGCCAACTCCGCC---ACCTATGGCTTTAAG
TRN  11011111101111111
NAM  FLGE_CAUCR/7-37
ASQ  MLAGVSGLIANSSALAAISDNIANVN-TVGFK
DSQ  ATGCTCGCCGGCGTTTCTGGTCTGATCGCGAACTCGTCGGCCCTTGCCGCGATCTCGGACAACATCGCCAACGTCAAC---ACCGTCGGCTTCAAG
TRN  11011111101111111
NAM  FLGF_CAUCR/5-35
ASQ  LYVGLSRQMTLRRELDIVANNIANAN-TTGFK
DSQ  CTTTATGTCGGCCTTTCGCGTCAGATGACGCTGCGCCGCGAGCTCGACATCGTGGCCAACAACATCGCCAACGCCAAC---ACCACGGGCTTCAAG
TRN  11011111101111111
NAM  FLGK_SALTY/4-34
ASQ  INHAMSGLNAAQAALNTVSNNINNYN-VAGYT
DSQ  ATTAATCACGCCATGAGCGGACTTAACGCCGCGCAGGCCGCGTTAAATACGGTCAGTAATAACATCAACAATTATAAC---GTTGCGGGTTATACC
TRN  11011111111111110
NAM  FLGK_BACSU/8-38
ASQ  LETARRALSAQQAALSTTANNVANAN-TDGYT
DSQ  CTTGAAACTGCAAGGCGGGCGTTAAGCGCTCAGCAGGCAGCGTTAAGCACTACTGCAAATAACGTGGCAAATGCCAAT---ACTGATGGTTATACA
TRN  10010101110011010
NAM  FLGC_SALTY/7-38
ASQ  FDIAGSALAAQSKRLNVAASNLANADSVTGPD
DSQ  TTTGATATTGCCGGATCGGCGCTTGCCGCACAGTCCAAACGGTTGAACGTTGCGGCCAGTAACCTGGCGAATGCGGATAGCGTCACCGGCCCGGAC
TRN  11011101101011011
NAM  FLGC_BACSU/7-37
ASQ  LNVSASALTAQRVRMDVVSSNLANMD-TTRAK
DSQ  TTAAATGTTTCAGCATCGGCTTTAACAGCTCAGCGAGTCAGAATGGACGTTGTATCATCTAACTTAGCAAATATGGAT---ACGACAAGAGCTAAG
TRN  10110101110011000
NAM  FLGF_SALTY/5-35
ASQ  IYTAMGAASQTLNQQAVTASNLANAS-TPGFR
DSQ  ATTTATACCGCCATGGGGGCGGCCAGCCAGACGCTTAACCAGCAGGCGGTAACGGCCAGCAACCTGGCTAATGCCTCA---ACGCCGGGCTTTCGC
TRN  11011111101111101
NAM  FLGB_BACSU/8-38
ASQ  IQNLENALSRADIKQKVITNNIANID-TPNYK
DSQ  ATACAAAATCTTGAAAATGCCTTGAGCAGAGCGGATATTAAGCAAAAAGTCATAACTAATAATATCGCCAATATAGAT---ACACCGAACTATAAG
TRN  10010101110011011
NAM  FLGB_SALTY/8-38
ASQ  LRFQQEALNLRAQRQEILAANIANAD-TPGYQ
DSQ  TTACGATTTCAGCAGGAAGCGCTAAATCTGCGCGCGCAACGTCAGGAAATATTAGCGGCGAATATCGCCAATGCCGAT---ACGCCGGGGTATCAG
TRN  10010111100111010
NAM  FLA1_BORBU/173-204
ASQ  LRVHVGANQDEAIAVNIYAANVANLFSGEGAQ
DSQ  TTAAGAGTTCATGTTGGAGCAAACCAAGATGAAGCTATTGCTGTAAATATTTATGCAGCTAATGTTGCAAATCTTTTCTCTGGTGAGGGAGCTCAA
TRN  10010101110011010
//