EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00426 - VP4)
FAM  PF00426
PID  VP4
DES  Outer Capsid protein VP4 (Hemagglutinin)
IPR  IPR000416
ANO  9
ALN  790
AID  0.601574
APH  ((((((VP4_ROTEH/1-776:0.11891,VP4_ROTB4/1-776:0.21355):0.03144,VP41_ROTS1/1-776:0.11957):0.03041,(VP4_ROTH1/1-775:0.15090,VP4_ROTH5/1-775:0.14707):0.11771):0.05297,VP4_ROTF1/1-775:0.24498):0.11138,VP4_ROTB9/1-770:0.30736):0.14400,VP4_ROTBA/1-772:0.25297,VP4_ROTPC/1-736:1.29741);
ATP  ((((((VP4_ROTEH/1-776,VP4_ROTB4/1-776),VP41_ROTS1/1-776),(VP4_ROTH1/1-775,VP4_ROTH5/1-775)),VP4_ROTF1/1-775),VP4_ROTB9/1-770),VP4_ROTBA/1-772,VP4_ROTPC/1-736);
ATL  3.33278
DNO  7
DLN  2370
DID  0.607481
DPH  (((((VP4_ROTH5/1-775:0.21706,VP4_ROTB4/1-776:0.22152):0.05142,VP4_ROTEH/1-776:0.15299):0.03798,VP41_ROTS1/1-776:0.15972):0.08433,VP4_ROTF1/1-775:0.22189):0.10584,VP4_ROTB9/1-770:0.24737,VP4_ROTPC/1-736:0.76454);
DTP  (((((VP4_ROTH5/1-775,VP4_ROTB4/1-776),VP4_ROTEH/1-776),VP41_ROTS1/1-776),VP4_ROTF1/1-775),VP4_ROTB9/1-770,VP4_ROTPC/1-736);
DTL  2.26466
RID  0.594554
RPH  ((VP4_ROTF1/1-775:0.23576,(VP4_ROTB9/1-770:0.27472,VP4_ROTPC/1-736:1.35104):0.12108):0.05641,VP4_ROTH5/1-775:0.23131,((VP41_ROTS1/1-776:0.12226,VP4_ROTEH/1-776:0.12862):0.03488,VP4_ROTB4/1-776:0.20546):0.02628);
RTP  ((VP4_ROTF1/1-775,(VP4_ROTB9/1-770,VP4_ROTPC/1-736)),VP4_ROTH5/1-775,((VP41_ROTS1/1-776,VP4_ROTEH/1-776),VP4_ROTB4/1-776));
RTL  2.78363
LNK  VP41_ROTS1/1-776:P04508:Y00336
LNK  VP4_ROTB4/1-776:P25173:M63267
LNK  VP4_ROTB9/1-770:Q08010:D16352
LNK  VP4_ROTBA/1-772:P36307:
LNK  VP4_ROTEH/1-776:Q02945:L04638
LNK  VP4_ROTF1/1-775:P39034:D10971
LNK  VP4_ROTH1/1-775:P11198:
LNK  VP4_ROTH5/1-775:P30214:M32559
LNK  VP4_ROTPC/1-736:P26193:M74218
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VP4_ROTPC/1-736
ASQ  MASSLYQQLISQNYYSIGNEILTDQQTTETVVDYVDAGNYTYAQLPPTKWGARGTFKSAFNVSNITGPHTNTIIEWSNLLNSNGWVIYQKPANTTKLFKHGPETYNSNLAAFELWYGKAGTSVTSDYYSSLQNNEKTVTATSDSLILFWNEGSTVLANKKVNFSWDMGGMLIKPTRGNRVDICMANMNDFNSSIFNWEEWKHEFPRSDVNINVNMYTDYYLASE--DPYT--ELKALQQ-PNITTFEMKMMKIIR-NGSINLNEVVSKDSLWQEVRYARDITLECKIESEVVKGGGWGYDYTSVAFKTVNHTYTYTRAGEIVNAHVTISFNNMKERSY-GGSLPTDFKIGRFDVIDTDTYMYIDYWDDSEIFKNMVYVRDLSANIGGFFYYAEMSYYFQIPVGAHPGLHSSGVRFVYERCLLSQQFTDQVALNSMRFIFRVTESNGWFMTSGNINTRRIASGTGFAYADG--HTSQTVGNITFISLIPSNPNYQTPIASSSTVRMDLERKINDLRNDFNQLANSVALGDILSLATSPLTFANLLESVPAIASSVKDVAANVMKKFRN----------TKMFKKATKAK------------YSEFIIGD-LLEDVTN--------------------VARNSNG.MNFDDITSAVMVSTTNKLQLTDVDTLSEIVARSADNFIPNRSYRMIEDGIVYEATPK-RTFSYDLTTLQQREFDIDKFMRLASKSPVISAIVDFATLKAMRETYGVGTDVIYKLVASDAPTILSFIDNNNPLIKSRIEELLRQCRL
DSQ  ATGGCGTCCTCACTTTATCAGCAGTTAATTTCACAAAATTATTATTCTATTGGAAACGAAATATTAACAGATCAACAGACAACAGAAACTGTAGTAGATTATGTAGATGCTGGTAATTATACATACGCGCAATTACCACCTACTAAATGGGGAGCACGTGGGACTTTTAAGTCTGCATTTAATGTATCAAATATAACTGGACCTCATACGAATACAATAATAGAATGGAGTAATTTACTAAATTCTAACGGATGGGTCATTTATCAAAAACCGGCCAATACTACAAAATTATTTAAACATGGACCAGAAACTTATAACAGTAACTTGGCAGCATTTGAATTATGGTATGGTAAAGCTGGTACATCAGTTACATCAGACTATTATTCTTCATTACAGAATAATGAAAAAACTGTGACAGCTACTTCAGATTCATTGATACTATTTTGGAATGAAGGATCTACAGTGTTAGCTAATAAAAAGGTAAATTTTAGCTGGGACATGGGTGGTATGTTAATAAAACCTACGAGAGGCAATAGAGTGGACATCTGCATGGCAAACATGAATGATTTCAATAGTAGCATATTTAATTGGGAAGAATGGAAACATGAATTTCCACGCAGTGATGTTAATATAAATGTTAATATGTATACAGATTATTATCTTGCGAGTGAA------GATCCTTATACT------GAACTTAAAGCACTACAGCAA---CCAAACATTACAACTTTTGAGATGAAAATGATGAAAATAATCCGT---AATGGGTCAATAAACTTGAATGAAGTAGTAAGTAAAGACTCACTATGGCAGGAGGTAAGATATGCTAGGGATATAACGTTAGAGTGTAAGATAGAATCAGAAGTAGTCAAAGGTGGTGGATGGGGTTATGACTACACGAGTGTAGCTTTTAAAACTGTTAATCATACATACACGTATACTCGAGCTGGTGAAATAGTAAATGCACATGTTACCATTAGTTTTAATAATATGAAAGAACGATCATAC---GGGGGTTCATTACCGACTGATTTCAAAATAGGAAGGTTTGATGTAATTGATACTGATACTTATATGTATATAGATTATTGGGACGATTCAGAAATTTTCAAAAATATGGTGTATGTGCGTGATTTAAGTGCTAACATTGGTGGTTTCTTTTATTATGCTGAAATGTCATATTATTTTCAAATTCCTGTAGGTGCACATCCAGGATTACATTCATCAGGAGTAAGATTTGTATATGAAAGATGTCTTTTATCACAACAATTCACTGACCAAGTTGCACTTAACTCTATGAGGTTCATATTTAGAGTGACAGAATCAAATGGTTGGTTTATGACATCAGGTAATATTAATACTAGACGGATAGCATCAGGAACTGGATTTGCATATGCAGACGGG------CATACTTCTCAAACAGTTGGAAATATTACTTTCATATCATTGATCCCAAGTAATCCAAATTATCAGACACCAATAGCATCATCAAGCACAGTCAGGATGGATTTAGAAAGGAAGATAAATGATTTACGTAATGATTTTAATCAGCTAGCTAATTCAGTCGCATTAGGTGACATTCTATCTTTGGCAACTTCACCACTAACTTTTGCTAATTTGCTTGAATCAGTGCCTGCTATCGCTTCATCAGTTAAAGATGTTGCAGCTAATGTAATGAAAAAATTTAGAAAC------------------------------ACTAAAATGTTTAAAAAAGCTACAAAAGCTAAA------------------------------------TATAGTGAGTTTATTATTGGAGAT---TTGTTGGAAGATGTAACGAAT------------------------------------------------------------GTTGCACGAAATTCAAATGGC...ATGAATTTTGATGACATTACATCCGCTGTGATGGTATCAACTACTAATAAACTACAACTTACTGACGTAGACACACTCTCAGAGATTGTCGCTAGATCAGCTGATAATTTTATCCCTAACAGATCTTACAGAATGATAGAAGACGGTATTGTGTATGAAGCAACACCAAAA---CGAACTTTCTCATACGATCTTACAACATTGCAACAGAGGGAATTTGACATAGATAAGTTCATGCGATTGGCATCTAAATCACCAGTAATATCTGCAATAGTAGATTTTGCAACATTAAAGGCTATGAGAGAAACATATGGTGTAGGAACGGACGTAATATACAAATTAGTAGCCTCAGATGCTCCAACGATATTATCATTCATCGATAACAACAATCCGTTGATTAAAAGTAGAATTGAGGAACTATTAAGACAATGCAGATTA
TRN  10010101110011000
NAM  VP4_ROTBA/1-772
ASQ  MASLIYRQLLYNSYSVDLSDEITNIGAEKKENVTVQIGGFAQSQYAPVSWGSGETLSGNVEEQTLDGPY-----APDSSNLPSNCWYLVNPSNDGVVFSW---TDNSTFWMFTYLVLPNTAQTNVTVNVMNETVNISIDNSG-STYRFEDYIKTSPTQSYGSRNYLNTAHRLQAYRRDGDGNISNYWGADTQGDLRVGTYSHPVPNAVINLNADFYVIPDSQQEICTEYIRGGLPAMQTTTYVTPISYAVRSQR--VARPNEDIIISKASLWKEVQYNRDIVIRFVFANNIIKAGGLGYKWSEISYKANNYQYTYMRDGVEVVAHTTVSVNGVSVYNYNTGPLPTDFMIRNYDVLKESSFVYVDYWDDSQAFRNMVYVRSLNAE-LNQVRCVGGHYSFALPVGSWPVMQGGSVILTFDSVTLSTQFTDYVSLNSLRFRFRCAVSEPPFRVTGTRISNLY--GLPAANPMGDQQYYEASGRFSLISLVPSNDDYQTPIANSVTVRQDLERQLDEMRREFNELSANIALSQLIDLALLPLDMFSMFSGIQSTVEAAKTFATSVMKKFRKSDLAKSVNSLTDAITDAAGSISRSSTLRSVNSVASVWTDISDIVDSTDN---VVAATATAAAKKFRVKEFTTEFNG.VSFDDISAAVVKTKMNKLNVVDEELLPQIITEASEKFIPNRAYRLIDGEKVYEVTTEGKYFAYLTETFEEVVFDAERFAELVTDSQVISAIIDFKTIKNLNDNYGITREQALNMLRSDPKVLRSFINQNNPIIKNRIEQLILQCRI
NAM  VP4_ROTB9/1-770
ASQ  MASLVYRQLLANSYTSDLQDTIDDISAQKTENVTVNPGPFAQTGYALVEWTHGDITTDETVQQTLDGPY-----APSSVIIQPQYWVLMNPETADVIAEA---DATN-KKYACVMLAPNTEEGDKQYTILGRQITINLGNTDQNRYKFFDLASENGE-TYSKIQELLTPNRLNAFMKDQ-GRLYVYHGTVPNISTGYYTLDD-IANVQTNIKCNYYIVPKSQTQQLEDFLKNGLPPIQESRYIMPVERSVQNIY--RAKPNEDIVISKTSLWKEMQYNRDIVIRFKFGNTIIKSGGLGYKWSEISYKPMNYEYTYERDGETVVAHTTCSVAGVNDFGYNSGSLPTDFVVSKYEVLKGNSYVYIDYWDDSQAFKNMVYVRSLSAE-FNAINCTGGTYDFQLPVGQWPQMRGGNVTLNSDAVTLSTQYTDFVSLNSLRFRFKPAIGEPFFEITRTRETRLY--GLPASNPMGGNEYYETAGRFSLISLVPSNDDYQTPIQNSTTVRQDLEQQISDLREEFNQLSSEIAMSQLIDLALLPLDMFSMFSGIKSTIDAVKSVTTSVMKKMKTSTLAKSVSTITEELSDAATSVSRASSIRSN---ASVWNNLVDTRTQTSVATNDIATQTSRIASKLRVKEFATQTEGgLSFNDISAAVLKTKIDKIETVQPKILPTIITESVDKFIPTRQYRIIDKDIAYEISNSGKYFAYRVDTFEEVIFDVEKFADLVTDSPVISAIIDFKTLKNLNDNFGITKEQAYNLLRSDPRVLKDFINQNNPIIRNRIEQLILQCRI
DSQ  ATGGCTTCTCTCGTATATAGACAACTTCTAGCAAACTCGTACACTTCAGATCTACAGGATACGATAGATGACATTTCAGCTCAAAAAACTGAAAATGTTACTGTTAATCCAGGACCGTTTGCACAGACAGGGTATGCTCTAGTCGAATGGACACATGGTGACATCACGACAGATGAAACTGTGCAACAAACTTTGGATGGACCGTAT---------------GCGCCATCTTCTGTGATAATTCAACCGCAATATTGGGTACTAATGAACCCGGAGACTGCAGATGTGATTGCTGAAGCG---------GATGCAACGAAC---AAGAAATATGCCTGTGTAATGCTAGCGCCTAACACAGAAGAAGGTGACAAACAATATACCATACTTGGACGTCAAATTACAATAAATTTGGGAAATACTGATCAAAATAGATATAAGTTCTTTGATTTAGCTAGTGAAAATGGAGAA---ACGTATTCAAAGATACAAGAACTGCTAACTCCTAATAGATTAAATGCCTTTATGAAAGATCAA---GGACGGTTGTATGTATATCATGGAACAGTGCCAAATATATCAACTGGTTATTATACACTAGATGAT---ATAGCAAACGTTCAAACGAACATTAAGTGTAATTATTATATAGTGCCAAAAAGTCAGACTCAACAACTAGAAGATTTCTTGAAAAATGGTTTGCCACCAATTCAGGAATCAAGATACATAATGCCAGTTGAGCGATCAGTGCAAAACATATAC------CGAGCAAAACCGAACGAAGACATAGTGATTTCAAAAACTTCGCTCTGGAAAGAAATGCAGTACAATAGGGATATCGTTATTAGATTTAAATTTGGGAATACTATAATTAAATCAGGTGGACTTGGATACAAATGGTCAGAAATATCATATAAGCCAATGAATTATGAATATACGTATGAACGAGATGGTGAAACAGTAGTTGCACATACCACCTGTTCTGTTGCAGGTGTAAACGATTTTGGTTATAATTCTGGATCACTACCAACTGATTTCGTCGTGTCAAAGTACGAAGTTTTAAAAGGAAACTCGTACGTGTATATAGATTACTGGGATGACTCTCAGGCATTTAAAAACATGGTATATGTACGGTCGCTAAGTGCAGAA---TTTAATGCGATAAATTGTACTGGAGGTACATATGATTTTCAACTTCCAGTTGGACAATGGCCACAAATGCGTGGCGGTAACGTGACACTTAATTCAGACGCAGTAACTCTGTCAACCCAGTATACTGATTTTGTGTCATTAAATTCATTAAGATTTAGATTTAAACCTGCAATTGGCGAACCGTTCTTTGAAATAACAAGAACAAGAGAAACTAGACTGTAT------GGTCTACCCGCGTCTAATCCTATGGGAGGGAACGAATATTATGAAACAGCTGGAAGATTCTCATTGATATCTTTAGTACCATCAAATGATGACTATCAAACACCAATTCAGAACTCGACGACCGTCAGGCAAGATCTAGAACAACAGATATCAGATTTACGGGAAGAGTTTAATCAGCTGTCATCGGAAATAGCAATGTCTCAGCTAATTGACCTAGCACTATTACCACTAGATATGTTCTCAATGTTTTCTGGAATTAAATCAACGATAGATGCAGTTAAATCAGTAACTACTTCAGTTATGAAGAAAATGAAAACGTCGACGCTGGCTAAATCTGTATCCACCATTACAGAAGAATTATCTGACGCTGCAACAAGTGTATCACGAGCATCATCAATACGTTCAAAT---------GCTTCTGTGTGGAACAATTTAGTCGATACACGTACGCAAACCTCAGTAGCAACGAATGATATTGCCACACAAACATCACGTATTGCGTCGAAATTAAGAGTGAAAGAATTCGCAACACAGACCGAAGGAggaTTGAGTTTTAATGACATTTCAGCTGCCGTATTAAAAACCAAAATAGATAAAATAGAGACTGTGCAACCAAAGATATTACCAACGATTATTACTGAATCAGTTGACAAGTTCATCCCAACGCGTCAGTATAGAATTATTGATAAAGATATCGCGTATGAAATATCAAACAGTGGGAAATATTTTGCATATAGGGTAGACACATTTGAAGAGGTGATTTTTGACGTAGAAAAATTCGCTGATCTAGTGACTGATTCACCAGTAATTTCAGCAATAATTGATTTTAAAACACTAAAGAACCTGAATGATAACTTCGGAATAACGAAAGAACAAGCGTATAACCTATTGCGCTCAGACCCAAGAGTGCTGAAAGACTTTATTAACCAAAATAATCCAATCATCAGAAACCGTATTGAACAATTAATATTACAATGTAGAATA
TRN  10010101100011000
NAM  VP4_ROTF1/1-775
ASQ  MASLIYRQLLSNSYVTNISDEVNEIGTKKTTNVTVNPGPFAQTGYAPVDWGHGELPDSTLVQPTLDGPY-----QPTSLNLPVDYWMLIAPTREGRVAEG---TNTTDRWFACVLVEPNVQNTQRQYVLDGQNVQLQVSNDSSTSWKFILFIKLTPDGTYTQYSTLSTPHKLCSWMKRD-NRVYWYQGSSPNASESYYLTIN-NDNSNVSSDAEFYLIPQSQTAMCTQYINNGLPPIQNTRNIVPVNIASRQIKDIRAQMNEDIVISKTSLWKEMQYNRDIIIRFKFANSIIKSGGLGYKWSEISFKPMNYQYTYTRDGEEVTAHTTCSVNGVNDFNYNGGTLPTDFAISRFEVIKENSYVYVDYWDDSQAFRNMVYVRSLAAN-LNDVVCSGGSYSFALPVGNHPVMSGGAVTLTSAGVTLSTQYTDYVSLNSLRFRFRLAVSEPSFSISRTRMSGIY--GLPAVNPNNNAEYYEIAGRFSLISLVPTNDDYQTPIANSVTVRQDLERQLGELREEFNSLSQEIAVSQLIDLATLPLDMFSMFSGIKSTVEAVKSMTTNVMKRFKTSSLANAISDLTSNMSEAASSV-RLTSVRSIGTVTLPRARVSLQVSDDLRSMQDVSTQVSNVSRNLRLKEFTTQTDT.LSFDDISAAVLKTKLDKSTQISQQTMPDIIAESSEKFIPKRSYRIVDEDTAFETGIDGTFYAYKVDTFNEIPFDMERFNKLITDSPVLSAIIDFKTLKNLNDNYGITKKQAMELLHSNPKTLKEFINNNNPIIRNRIENLISQCRL
DSQ  ATGGCTTCTTTAATTTATAGACAGTTATTATCAAACTCATATGTTACGAACATCTCTGACGAAGTTAACGAAATTGGAACTAAAAAAACAACTAACGTTACTGTTAATCCAGGGCCGTTCGCACAAACGGGATATGCGCCTGTTGATTGGGGACATGGTGAATTGCCTGATTCTACATTAGTGCAACCAACTCTCGATGGTCCATAT---------------CAACCCACTTCACTCAACTTACCAGTTGATTATTGGATGTTAATTGCGCCTACTAGAGAAGGAAGAGTTGCTGAAGGT---------ACGAATACGACTGACAGATGGTTTGCTTGTGTGCTAGTTGAACCAAATGTACAAAATACACAAAGACAATACGTATTAGATGGGCAAAATGTCCAATTGCAGGTCTCAAACGATTCAAGTACTTCGTGGAAATTTATATTATTCATTAAATTGACGCCTGACGGAACGTACACTCAATACTCAACCTTGTCAACACCGCATAAGTTATGCTCGTGGATGAAAAGGGAC---AACAGAGTGTACTGGTATCAAGGATCGTCGCCGAACGCATCAGAGAGCTATTATTTGACTATAAAC---AATGATAACAGCAACGTTTCAAGTGACGCTGAATTTTATTTGATACCGCAATCGCAGACTGCTATGTGTACACAATATATAAATAATGGTTTACCACCAATTCAGAATACAAGGAATATTGTACCAGTAAATATTGCATCTAGACAGATTAAAGACATAAGAGCTCAGATGAATGAAGACATAGTAATATCGAAAACTTCATTATGGAAAGAAATGCAATATAATAGAGATATAATCATTAGATTTAAATTTGCTAATTCAATAATCAAATCAGGTGGACTAGGTTATAAGTGGTCGGAAATATCATTTAAGCCCATGAACTATCAATATACGTACACAAGAGATGGAGAAGAAGTGACAGCACATACAACATGTTCAGTGAATGGTGTCAATGATTTTAATTATAATGGAGGTACGTTACCTACTGATTTTGCAATATCGAGATTTGAGGTCATAAAGGAAAATTCTTATGTATATGTAGATTATTGGGATGATTCACAAGCATTTAGAAATATGGTATATGTAAGGTCGTTAGCTGCAAAT---TTGAATGATGTAGTATGCAGTGGAGGTTCTTACAGTTTTGCGTTACCTGTAGGCAATCATCCGGTGATGAGTGGTGGCGCAGTGACCTTAACATCTGCTGGTGTAACACTATCAACTCAGTATACAGATTATGTATCATTAAATTCATTGCGATTCAGATTCAGATTGGCGGTGAGCGAACCATCATTTTCTATCTCGCGAACTAGAATGAGTGGCATATAC------GGATTACCAGCTGTAAATCCAAATAATAACGCAGAATATTATGAGATAGCTGGTAGATTCTCACTCATATCACTAGTACCAACAAATGATGACTATCAAACGCCAATCGCTAATTCAGTTACCGTGAGACAAGATTTAGAGAGACAATTAGGTGAGTTAAGAGAAGAATTCAATTCGTTGTCACAAGAAATAGCTGTTTCCCAACTTATAGACCTAGCAACACTACCGCTTGATATGTTCTCAATGTTCTCTGGAATAAAATCAACGGTAGAGGCAGTAAAATCTATGACTACGAACGTGATGAAAAGATTTAAAACATCAAGTTTAGCAAACGCCATATCTGATTTAACAAGCAATATGTCGGAAGCGGCATCATCTGTA---AGATTGACGTCAGTAAGATCGATTGGCACTGTTACATTGCCAAGAGCTAGAGTTTCATTGCAAGTAAGTGATGACTTAAGGTCTATGCAGGACGTATCAACACAAGTGTCAAATGTGAGTAGAAATTTGAGATTGAAAGAGTTCACGACGCAAACTGATACT...TTAAGCTTTGATGACATCTCTGCAGCTGTATTGAAGACGAAACTAGACAAATCGACGCAAATTTCACAACAAACGATGCCAGATATTATAGCTGAGTCATCTGAAAAGTTTATACCGAAAAGATCGTACAGAATAGTTGATGAGGATACCGCATTCGAAACTGGAATTGACGGAACGTTTTATGCTTACAAAGTCGATACATTTAATGAAATTCCGTTTGATATGGAACGATTTAATAAATTAATAACAGACTCACCAGTTTTATCAGCAATAATAGACTTTAAGACGTTAAAGAACTTAAACGATAATTATGGAATAACAAAGAAACAAGCCATGGAACTATTACATTCAAATCCAAAGACATTAAAAGAGTTTATAAATAATAATAATCCAATAATTAGAAATAGAATTGAAAATTTAATATCGCAGTGTAGGTTG
TRN  10010101110011000
NAM  VP4_ROTH5/1-775
ASQ  MASLIYRQLLTNSYSVDLHDEIEQIGSEKTQSVTVNPGPFAQTRYAPVNWGHGEINDSTTVEPVLDGPY-----QPTTFKPPNDYWFLISSNTDGVVYES---TNNNDFWTAVIAVEPHVSQTNRQYILFGENKQFNVENNS-DKWKFFEMFKGSSQGDFSNRRTLTSNNRLVGMLKYG-GRVWTFHGETPRATTDSSNTAD-LNNISIMIHSEFYIIPRSQESKCNEYIKNGLPPIQNTRNVVPLSLSSRSIQYRRAQVNEDITISKTSLWKEMQYNRDIIIRFKFGNSVIKLGGLGYKWSEISYKAANYQYSYSRDGEQVTAHTTCSVNGVNNFSYNGGSLPTDFSISRYEVSKENSYVYIDYWDDSKAFRNMVYVRSLAAN-LNSVKCTGGSYDFRLPVGGWPIMNGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVDEPSFSIIRTRTINLY--GLPAANPNNGNEYYEMSGRFSLISLVLTNDDYQTPIMNSVTVRQDLERQLNDLREEFNSLSQEIAMSQLIDLALLPLDMFSMFSGIKSTIDLTKSMATSVMKKFRKSKLATSISEMTNSLSDAASSASRSASIRSNLSTISNWTNTSKSVSNVTDSVNDVSTQTSTISKKLRLREMITQTEG.MSFDDISAAVLKTKIDMSTQIGKNTLPDIVTEASEKFIPKRSYRVLKDNEVMEINTEGKFFAYKVDTLNEIPFDINKFAELVTDSPVISAIIDFKTLKNLNDNYGITRIEAFNLIKSNPNVLRNFINQNNPIIRNRIEQLILQCKL
DSQ  ATGGCTTCGCTCATTTATAGACAACTTCTCACTAATTCATATTCGGTAGACTTGCATGATGAAATAGAACAGATTGGATCGGAGAAAACTCAAAGTGTAACAGTAAATCCAGGTCCATTTGCACAAACCAGATACGCTCCAGTTAATTGGGGACATGGGGAGATTAATGATTCAACTACAGTGGAACCAGTTTTAGATGGTCCTTAT---------------CAACCCACTACATTCAAACCACCCAATGATTATTGGTTCCTTATTAGTTCAAATACAGATGGAGTAGTCTACGAAAGT---------ACAAATAATAATGATTTTTGGACAGCAGTTATCGCAGTTGAACCACATGTTAGTCAAACAAATAGGCAATATATTTTATTTGGTGAAAATAAACAGTTTAACGTAGAAAACAATTCA---GATAAATGGAAATTTTTCGAAATGTTTAAAGGTAGTAGTCAGGGTGATTTTTCTAATAGACGGACTCTAACCTCTAACAATAGACTTGTAGGGATGCTAAAATATGGT---GGAAGAGTATGGACATTTCATGGTGAAACACCAAGAGCTACTACTGATAGTTCAAATACTGCGGAT---TTAAATAATATATCAATTATGATTCATTCAGAGTTTTATATTATTCCAAGATCCCAAGAATCTAAATGTAACGAGTATATCAAGAATGGTTTACCACCAATTCAGAATACTAGAAACGTAGTTCCATTATCTTTATCATCCAGATCTATTCAGTATAGGAGAGCACAAGTTAATGAAGATATTACAATTTCAAAAACTTCATTATGGAAGGAAATGCAATATAATAGAGATATTATAATAAGATTTAAATTTGGTAATAGTGTTATAAAACTAGGAGGATTGGGATATAAATGGTCTGAAATATCATATAAAGCAGCGAATTATCAGTATAGTTATTCACGTGATGGTGAACAAGTTACTGCACATACCACTTGTTCAGTAAATGGAGTAAATAATTTTAGCTATAATGGAGGTTCACTACCTACTGATTTCAGTATTTCGAGATATGAAGTTAGTAAAGAAAATTCTTATGTGTATATAGACTACTGGGATGATTCAAAAGCATTTAGAAATATGGTGTATGTTAGATCGCTAGCAGCAAAT---TTAAATTCAGTGAAATGTACAGGTGGGAGTTATGATTTTAGATTGCCCGTAGGTGGATGGCCTATTATGAATGGTGGTGCTGTATCATTACATTTTGCTGGAGTTACATTATCTACACAGTTCACTGATTTTGTATCATTAAATTCACTGCGATTTAGATTCAGTTTAACAGTAGATGAACCATCTTTCTCAATAATACGAACACGTACAATAAACTTGTAC------GGATTACCAGCAGCTAATCCGAACAATGGAAATGAGTACTATGAAATGTCAGGAAGGTTTTCACTTATTTCTTTAGTTCTAACCAATGATGATTATCAAACTCCAATTATGAATTCAGTAACAGTAAGGCAGGATTTAGAACGCCAGCTTAATGATTTGCGAGAAGAATTTAATTCATTGTCACAAGAAATAGCTATGTCACAATTAATTGATTTAGCATTACTACCTTTAGATATGTTCTCTATGTTTTCGGGAATAAAAAGTACAATTGATCTAACCAAATCAATGGCAACTAGTGTAATGAAAAAATTTAGAAAATCGAAATTAGCTACATCAATTTCAGAAATGACTAATTCATTGTCAGATGCGGCTTCATCAGCATCAAGAAGTGCTTCTATTAGATCAAATTTATCTACGATTTCAAATTGGACTAATACTTCAAAAAGTGTGTCAAATGTAACTGACTCAGTAAATGATGTTTCAACACAAACATCTACAATTAGTAAGAAACTTAGATTAAGAGAGATGATTACTCAAACTGAAGGA...ATGAGTTTTGATGATATTTCAGCAGCTGTACTGAAAACGAAAATAGATATGTCCACACAAATTGGAAAAAACACTTTACCTGATATAGTTACTGAAGCGTCTGAAAAATTTATTCCAAAACGATCATATCGAGTATTAAAAGATAATGAAGTAATGGAAATTAACACTGAAGGAAAGTTTTTTGCATATAAAGTGGATACACTCAATGAGATACCATTTGATATAAATAAATTCGCCGAACTTGTCACGGATTCTCCAGTTATATCAGCGATAATAGACTTTAAGACGTTAAAAAATTTAAACGACAATTATGGAATTACTCGTATTGAAGCGTTTAATTTAATTAAATCGAATCCAAATGTGCTACGTAATTTCATTAATCAAAATAATCCAATTATAAGAAATAGAATTGAGCAGTTAATTCTACAATGTAAGTTG
TRN  10010101100011000
NAM  VP4_ROTH1/1-775
ASQ  MASLIYRQLLTNSYSVELSDEINTIGSEKSQNVTINPGPFAQTNYAPVVLESWEVNDSTTIEPVLDGPY-----QPTSFKPPSDYWILLNPTNQQVVLEG---TNKTDIWVALLLVEPNVTNQSRQYTLFGETKQITVENNT-NKWKFFEMFRSSVSAEFQHKRTLTSDTKLAGFLKFY-NSVWTFYGETPHATTDYSSTSN-LSEVETAIHVEFYIIPRSQESKCNEYINTGLPPMQNTRNIVPVALSSRSVTYQRAQVNEDIIISKTSLWKEMQYNRDIIIRFKFNNSIVKLGGLGYKWPEISFKAANYQYNYLRDGEQVMAHTTCSVNGENNYSYNGGLLPTHFSVSRYEVIKENSYVYDNYWDDSQAFRNMVYVRSLAAN-LNSVKCSGGNYNFQMPVGAWPVMSGGAVSLHFAGVTLSTEFTDFVSLNSLRFRFSLTVEEPPFSILRTRVSGLY--GLPAFNPNNGHEYYEIAGRFSFILLVPSNDDYQTPIMNSVTVRQDLERQLGDLREEFNSLSQEIAMTQLIDLALLPLDMFSMFSGIKSTIDAAKSMATMVMKKFKKSGLATSISELTRSLSNAASSVSRSSSIKSNISSISVWTDVSEQITGSSDSVRNISTQTSAISKRLRLREITTQTEG.MNFIDISAAVLKTKIDKSTHISPDTLPDIITESSEKFIPKRAYRVLKDDEVMEVDVDGKFFAYKVDTFEEVPFDVDKFVDLVTDSPVISAIIDFKTLKNLNDNYGITRSQALDLIRSDPRVLRDFINQNNPIIKNRIEQLILQCRL
NAM  VP4_ROTB4/1-776
ASQ  MASLIYRQLLANSYAVDLSDEIQSVGSEKNQRVTVDPGPFAQTGYAPVNRGPGEVNDSTVVQPVLDGPY-----QPAPFDLPVGNRMLLAPTGPGVVVEG---TDNSGRWLSVILIEPGVTSETRTYTMFGSSKQVLVSNVSDTKWKLFEMMKTAVDGDYAEWGTLLSDIKIYGMMKYG-ERLFIYEGETPNARTKGYIVTN-YTSVEVRPYSDFYIISRSQESACTEYINNGLPPIQNTRNVVPLAISSRSIKPRKVQPNEDIVVSKTSLWKELQYNRDIIIRFRFDNSIIKAGGLGYKWAEISFKAANYQYNYISDGEEVTAHTTCSVNGVNDFSFNGGSLPTDFAISRYEVIKENSYVYVHYWDDSQAFRNMVYVRSLAAN-LNDVMCSGGDYSFALLVGQWPVMKGGAVTLHTAGVTLSTQFTDFVSLNSLRFRFRLSVEEPSFTITRTRVSKLY--GLPAANPNGGREYYEVAGRFSLISLVPSNDDYQTPIMNSVTVRQDLERRLNELREEFNNLSQEIAVSQLIDLAILPLDMFSMFSGIEGTVNAAKSMATNVIRKFKSSKLASSVSMLTDSLSDAASSISRSTSIRSIGSTASAWTNISKQTQDAVNEVATISSQLSQISGKLRLKEITTQTEG.MSFDDISAAVLKANIDRSIQVDKNALPDVITEASEKFIRNRAYRVIDGDEAFEASTDGRFFAYKVETLEEMPFDIEKFADLVTRSPVISAIIDFKTLKNLNDNYGITREQAFNLLRSNPKVLRGFMDQNNPIIKNRIEQLIMQCRL
DSQ  ATGGCTTCGCTCATATACAGACAGCTGCTCGCTAATTCTTACGCAGTGGATTTGTCTGATGAGATACAGTCAGTTGGGTCAGAGAAGAACCAACGCGTTACAGTGGATCCAGGACCATTTGCGCAGACAGGATATGCACCAGTGAATCGGGGGCCTGGTGAAGTGAATGATTCGACTGTGGTACAACCTGTGTTGGATGGACCGTAT---------------CAACCAGCGCCGTTCGATCTACCAGTAGGAAATCGGATGTTGTTAGCACCAACAGGACCAGGTGTAGTAGTGGAAGGG---------ACGGACAATTCTGGCAGATGGTTATCTGTAATTCTGATTGAACCAGGTGTCACATCAGAGACTAGAACGTATACGATGTTTGGATCAAGTAAACAGGTGTTAGTGTCGAACGTGTCTGATACGAAATGGAAATTGTTTGAAATGATGAAGACGGCGGTTGATGGTGACTATGCGGAATGGGGAACATTATTATCGGACATTAAAATCTACGGGATGATGAAATATGGA---GAGAGATTATTCATATACGAAGGAGAAACCCCAAATGCCAGAACCAAAGGATACATTGTAACGAAT---TATACATCAGTTGAGGTAAGACCATATAGTGACTTCTATATAATTTCAAGATCGCAGGAATCAGCATGCACTGAGTACATAAACAACGGACTGCCGCCTATCCAAAATACCAGGAATGTAGTGCCTTTGGCGATATCATCCAGGTCAATTAAACCAAGAAAAGTGCAGCCTAATGAAGATATTGTAGTTTCTAAGACTTCATTATGGAAAGAATTGCAATACAATAGAGATATCATAATTAGATTTAGGTTTGATAACTCAATAATAAAAGCTGGAGGTTTGGGCTATAAGTGGGCTGAAATCTCATTTAAAGCTGCAAATTATCAATACAATTACATAAGCGACGGAGAAGAGGTTACAGCGCATACGACGTGTTCAGTTAATGGCGTTAATGATTTCAGCTTTAACGGAGGCTCGTTACCAACTGATTTCGCAATATCGAGATATGAAGTAATTAAAGAAAATTCGTATGTATACGTTCATTACTGGGATGATTCACAGGCATTCAGAAACATGGTCTACGTGCGATCATTGGCAGCGAAT---TTGAATGACGTAATGTGTTCTGGTGGAGATTATAGCTTCGCGCTACTTGTTGGACAGTGGCCGGTGATGAAAGGAGGGGCGGTAACGTTGCATACAGCAGGAGTAACATTATCTACACAATTCACCGACTTCGTATCGTTAAACTCACTAAGGTTTAGGTTTAGACTGTCTGTAGAAGAACCGTCATTCACGATAACTAGAACACGTGTATCAAAACTGTAT------GGTTTACCAGCAGCGAACCCAAACGGCGGAAGGGAATATTATGAAGTGGCAGGAAGGTTTTCGCTCATATCATTGGTGCCATCAAATGATGACTATCAAACGCCAATTATGAACTCAGTAACAGTAAGGCAAGACTTGGAAAGGCGTTTAAATGAGTTGAGAGAAGAGTTTAATAACTTATCACAAGAAATAGCTGTGTCACAGTTAATTGACTTAGCTATCCTGCCATTAGACATGTTTTCGATGTTCTCGGGAATTGAGGGTACTGTGAACGCAGCAAAATCAATGGCTACCAACGTGATAAGGAAATTTAAGAGCTCAAAACTCGCATCATCAGTGTCAATGTTGACGGACTCTTTATCCGATGCGGCCTCATCTATTTCAAGGAGTACATCAATACGATCAATAGGATCAACAGCATCAGCTTGGACTAATATTTCAAAACAGACACAAGACGCTGTTAATGAAGTTGCGACGATATCATCACAACTGTCACAAATAAGTGGGAAATTAAGATTGAAAGAAATTACGACTCAAACAGAAGGA...ATGAGTTTCGATGACATATCAGCGGCGGTGCTAAAAGCCAACATAGACAGATCAATACAGGTCGACAAAAATGCATTACCAGACGTCATCACAGAAGCGTCAGAGAAATTCATCCGTAATAGGGCGTATAGAGTGATAGACGGAGATGAAGCATTTGAAGCCAGCACTGATGGAAGATTTTTCGCGTACAAGGTGGAAACACTTGAGGAAATGCCATTCGATATAGAAAAATTTGCAGATTTAGTTACTCGCTCACCAGTGATATCAGCAATAATAGACTTCAAGACGTTGAAAAACCTGAATGACAATTATGGGATAACTAGAGAGCAAGCATTTAATTTGTTACGGTCAAACCCCAAAGTTTTGCGTGGATTTATGGACCAAAACAATCCAATTATAAAAAACAGGATAGAACAACTGATCATGCAATGTAGATTG
TRN  10010101100011000
NAM  VP4_ROTEH/1-776
ASQ  MASLIYRQLLANSYTVDLSDEIENIGYAKSKNVTINPGPFAQTGYTPVNWGPGEVNDSTTVEPILDGPY-----QPTNFNPPVNYWMLLSPLNAGVVVEG---TNSIDRWLATVLVEPNVLTTVRTYTLFGVQEQISVENNSTTKWKFINLIKTTLSGNFTLYSTLLSEPKLHGIMKHG-GQLWVYNGETPNATTTGYVTSN-YDSLTMTSFCDFYIIPRSQESTCTEYINNGLPPIQNTRNVVSVSISSRNIILNRAQVNKDIVISKTSLWKEVQYNRDITIRFRFANAIIKSGGLGYKWSEISFKPANYQYSYTRDGEEITAHTTCSVNGVNDFSFNGGSNPTDFLISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAAN-LNDVLCTGGDYTFALPVGQWPVMTGGAVMLHAAGVTLSTQFTDFVSLNSLRFRFSLSVEEPYFSITRTRVTRLY--GLPAVNPNNNRDYYEIAGRFSLISLVPSNDDYQTPIMNSVTVRQDLERQLGELREEFNTLSQEIAVSQLIDLALLPLDMFSMVSGIKSSIDAAKSMASNVMKKFKKSKLASSISTLTNSLSDASSSVSRNSSIRSVSSSVSAWTDVSNQLTDISNSVNSISTQTSTISRRLRLKEIATQTEG.MNFDDISAAVLKTKIDKSTQIAANNIPDIITEASEKFIPNRAYRVISNDNVFEASTDGRFFAYKVGTFEGIPFDVQKFADLVTDSPVISAIIDFKTLKNLNDNYGITREQAFNLLRSDPRVLREFINQDNPIIKNRIEQLILQCRL
DSQ  ATGGCTTCTCTTATTTACAGACAGCTACTCGCTAATTCTTATACAGTTGATCTATCTGATGAAATTGAAAATATTGGATATGCAAAAAGTAAAAATGTAACCATTAATCCAGGTCCATTCGCACAAACGGGATATACTCCAGTTAATTGGGGTCCTGGAGAAGTTAATGACTCAACAACAGTTGAACCAATTCTAGATGGTCCATAC---------------CAACCAACTAATTTCAATCCGCCAGTAAATTATTGGATGTTACTATCTCCTCTAAATGCTGGCGTTGTGGTTGAAGGA---------ACAAATAGTATTGATCGTTGGTTAGCGACTGTTCTAGTGGAACCAAACGTTCTAACAACTGTCAGAACATATACATTATTTGGAGTGCAAGAGCAGATATCAGTAGAAAACAATTCAACTACAAAATGGAAATTTATAAATTTAATTAAAACCACACTATCGGGCAATTTCACATTATATTCTACTCTACTATCAGAACCAAAATTGCATGGAATTATGAAACATGGT---GGACAGCTATGGGTTTATAATGGAGAAACTCCAAACGCTACTACTACAGGCTATGTAACTTCAAAT---TATGATTCACTTACTATGACATCCTTTTGTGACTTTTATATCATTCCTAGAAGTCAAGAGTCAACATGTACAGAGTATATTAATAATGGATTACCTCCAATACAAAACACTAGAAATGTAGTGTCAGTGTCTATTTCATCTCGTAATATAATACTCAATCGAGCTCAAGTAAATAAAGATATTGTAATATCAAAAACTTCGCTGTGGAAAGAAGTACAATATAATAGAGATATTACAATAAGATTTAGATTTGCGAATGCAATTATAAAATCAGGTGGACTAGGCTATAAATGGTCTGAAATTTCATTTAAACCAGCTAACTATCAATACTCATACACTAGAGATGGAGAAGAAATTACAGCACATACTACATGCTCTGTAAATGGTGTAAATGATTTCAGCTTTAATGGAGGTTCTAATCCTACTGATTTTCTAATTTCACGTTATGAAGTTATTAAAGAGAACTCATACGTCTATGTTGACTACTGGGACGACTCACAAGCATTTAGGAATATGGTATATGTTAGATCATTAGCAGCTAAT---CTAAATGATGTATTATGTACAGGTGGTGATTATACGTTCGCATTACCAGTGGGTCAGTGGCCAGTAATGACTGGAGGCGCTGTGATGTTACATGCTGCAGGTGTTACATTATCAACGCAATTTACTGACTTTGTTTCATTAAATTCATTACGATTTAGATTTAGTCTTTCAGTAGAAGAACCATATTTTTCAATTACTAGGACTCGAGTAACTAGATTATAT------GGATTACCAGCAGTAAATCCAAATAATAATAGAGATTATTATGAAATAGCTGGAAGGTTTTCTTTAATATCATTAGTACCATCTAATGATGATTACCAAACACCAATTATGAATTCAGTCACAGTTAGACAAGATTTGGAGCGACAGTTAGGAGAATTAAGAGAAGAATTTAACACTTTATCTCAAGAAATAGCTGTATCACAATTAATTGACTTAGCGTTACTTCCGTTAGATATGTTCTCAATGGTCTCAGGAATTAAAAGCTCTATTGACGCAGCAAAATCAATGGCTTCTAATGTAATGAAAAAATTTAAAAAATCAAAATTAGCTTCATCTATTTCAACATTAACTAATTCGCTGTCAGATGCGTCATCATCAGTTTCTAGGAACTCATCCATTAGATCAGTAAGTTCTTCTGTATCGGCATGGACTGATGTTTCAAATCAACTAACAGATATTTCAAATTCAGTAAACAGCATATCGACGCAAACATCAACAATAAGTCGTCGTCTAAGATTGAAGGAAATTGCTACTCAGACAGAAGGT...ATGAACTTTGACGACATTTCAGCAGCGGTATTGAAAACGAAAATTGATAAATCAACACAAATTGCAGCTAACAATATACCAGATATAATAACAGAAGCTTCTGAAAAATTCATACCAAACAGAGCATATAGGGTAATCAGTAACGATAACGTTTTCGAAGCAAGCACTGATGGACGATTCTTTGCTTATAAAGTAGGAACATTTGAAGGAATACCATTCGATGTGCAAAAATTTGCTGACTTAGTGACAGATTCACCAGTTATATCGGCAATCATAGATTTTAAAACCTTAAAAAATTTAAATGATAATTATGGAATAACAAGAGAGCAAGCTTTTAATTTATTACGATCTGATCCAAGAGTTTTGAGAGAATTTATTAATCAAGACAATCCAATAATTAAAAATAGGATAGAGCAATTAATATTACAATGTAGATTG
TRN  10010101100011000
NAM  VP41_ROTS1/1-776
ASQ  MAALIYRQLLTNSYTVELSDEIQEIGSTKTQNVTVNPGPFAQTNYAPVNWGPGETNDSTTVEPVLDGPY-----QPTTFNPPVSYWMLLAPTNAGVVVEG---TNNTNRWLATILIEPNVQQVERTYTLFGQQVQVTVSNDSQTKWKFVDLSKQTQDGNYSQHGSLLSTPKLYGVMKHG-GKIYTYNGETPNANTGYYSTTN-FDTVNMTAYCDFYIIPLAQEAKCTEYINNGLPPIQNTRNIVPVSIVSRNIVYTRAQPNQDIVVSKTSLWKEMQYNRDIVIRFKFANSIIKSGGLGYKWSEVSFKPAFYQYTYTRDGEEVTAHTTCSVNGVNDFNYNGGSLPTDFVISKYEVIKENSFVYIDYWDDSQAFRNMVYVRSLAAD-LNSVMCTGGDYSFALPVGNYPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLSVEEPPFSILRTRVSGLY--GLPAAKPNNSQEYYEIAGRFSLISLVPLNDDYQTPIMNSVTVRQDLERQLGELRDEFNNLSQQIAMSQLIDLALLPLDMFSMFSGIKSTIDAAKSMATNVMKRFKKSSLANSVSTLTDSLSDAASSISRSASVRSVSSTASAWTEVSNIASDINVTTSSISTQTSTISRRLRLKEMATQTDG.MNFDDISAAVLKTKIDKSTQLNTNTLPEIVTEASEKFIPNRAYRVIKDDEVLEASIDGKYFAYKVETFEEIPFDVQKFADLVTDSPVISAIIDFKTLKNLNDNYGISRQQALNLLRSDPRVLREFINQDNPIIRNRIESLIMQCRL
DSQ  ATGGCTGCACTCATTTATAGACAGTTGCTTACTAATTCATACACAGTAGAACTTTCAGATGAAATACAAGAAATTGGATCGACTAAGACTCAAAACGTTACCGTTAATCCAGGACCATTCGCGCAAACAAATTACGCTCCAGTTAATTGGGGACCTGGTGAAACGAATGACTCAACTACAGTTGAACCAGTGCTTGATGGACCATAT---------------CAACCAACGACTTTTAATCCACCTGTAAGTTATTGGATGTTGCTAGCACCAACGAACGCGGGGGTGGTAGTTGAAGGT---------ACGAACAATACAAACAGATGGTTAGCGACAATATTAATTGAACCAAATGTACAGCAAGTTGAGCGAACATATACATTATTTGGACAACAAGTTCAAGTAACGGTATCAAATGACTCGCAGACAAAGTGGAAGTTTGTGGATCTAAGTAAGCAAACACAAGATGGTAATTATTCACAGCATGGTTCTCTACTGTCGACACCAAAACTGTATGGAGTGATGAAGCATGGT---GGTAAGATTTACACTTATAATGGAGAGACACCGAACGCAAACACTGGTTACTACTCTACAACTAAC---TTTGACACTGTAAATATGACAGCATATTGCGATTTTTATATAATTCCATTAGCACAAGAGGCAAAATGCACTGAATACATAAATAATGGATTACCACCAATACAAAATACGAGAAATATCGTACCAGTTTCGATAGTATCAAGGAATATTGTATATACAAGAGCACAACCCAATCAAGACATCGTGGTATCAAAAACTTCATTATGGAAAGAGATGCAATATAATAGAGATATAGTGATAAGATTTAAATTTGCTAACTCAATCATAAAATCAGGGGGATTGGGATATAAATGGTCAGAAGTGTCATTTAAACCAGCGTTTTATCAGTACACATATACCAGAGATGGTGAAGAAGTTACTGCACATACTACGTGTTCAGTAAATGGGGTAAATGATTTTAATTATAATGGTGGATCATTACCGACTGATTTCGTAATATCAAAATATGAGGTAATTAAGGAAAATTCTTTTGTGTACATAGACTACTGGGACGATTCACAAGCATTTAGAAACATGGTATATGTACGCTCGTTGGCAGCTGAT---TTAAATTCAGTAATGTGTACAGGAGGTGACTATAGTTTTGCGCTTCCAGTTGGTAATTATCCAGTTATGACTGGGGGTGCTGTGTCATTGCATTCAGCAGGTGTAACTTTATCAACGCAGTTTACAGATTTCGTATCATTAAATTCACTGAGATTTAGATTTAGATTATCAGTAGAAGAACCGCCGTTCTCAATTCTACGGACCAGAGTTAGTGGATTGTAT------GGACTTCCAGCGGCAAAACCGAATAATTCACAAGAATATTATGAGATAGCTGGGAGATTTTCATTAATATCACTTGTACCGTTAAATGATGATTATCAGACACCAATCATGAATTCAGTTACTGTACGACAAGATTTAGAACGACAATTAGGAGAACTAAGAGATGAATTTAACAATTTATCACAACAAATCGCTATGTCACAATTGATAGATCTTGCGTTACTACCGTTAGATATGTTCTCAATGTTTTCAGGAATTAAGAGTACAATTGACGCAGCGAAGTCTATGGCGACGAACGTAATGAAGAGATTTAAAAAGTCAAGTCTCGCTAACTCAGTGTCAACGCTCACTGATTCATTGTCTGATGCAGCATCATCAATTTCTAGAAGTGCATCGGTTAGATCAGTTAGTTCAACTGCATCAGCTTGGACGGAAGTATCTAACATTGCATCAGATATTAATGTGACAACGAGCTCAATTTCTACACAGACATCAACAATAAGCAGAAGGTTAAGACTAAAAGAGATGGCGACTCAAACAGACGGT...ATGAATTTTGATGATATATCAGCGGCAGTACTTAAGACTAAAATTGATAAATCAACCCAGTTAAATACAAATACATTGCCAGAAATAGTGACTGAGGCTTCAGAAAAGTTTATACCAAATAGAGCGTACCGTGTAATTAAGGATGATGAAGTGCTGGAGGCTAGTATTGATGGTAAATATTTCGCTTACAAAGTTGAAACATTTGAAGAGATTCCATTCGATGTCCAGAAATTCGCCGACTTAGTGACTGACTCACCAGTTATATCGGCAATAATTGATTTTAAAACTCTCAAGAATCTAAATGATAATTACGGAATAAGCAGACAACAAGCACTAAATCTTCTAAGATCTGACCCGCGAGTATTGCGTGAATTTATTAATCAGGATAATCCAATAATACGAAATAGAATAGAAAGTTTGATAATGCAATGTCGCTTA
TRN  10010101100011000
//