EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00382 - TFIIB)
FAM  PF00382
PID  TFIIB
DES  Transcription factor TFIIB repeat
IPR  IPR000812
ANO  12
ALN  74
AID  0.288187
APH  ((TF2B_HALVA/30-100:0.15928,TF2B_PYRWO/212-282:0.39011):0.23237,(TF2B_DROME/214-284:0.34001,TF2B_KLULA/245-315:0.70062):0.26788,((((TF3B_CANAL/95-165:0.24905,TF3B_KLULA/98-168:0.13334):1.02302,(TF2B_DROME/120-190:0.42731,(TF2B_KLULA/137-207:0.15814,TF2B_YEAST/133-203:0.12079):0.57550):0.34554):0.20559,TF2B_PYRWO/116-186:0.37106):0.58148,(TF3B_CANAL/190-263:0.33155,TF3B_KLULA/193-266:0.02009):0.80611):0.25929);
ATP  ((TF2B_HALVA/30-100,TF2B_PYRWO/212-282),(TF2B_DROME/214-284,TF2B_KLULA/245-315),((((TF3B_CANAL/95-165,TF3B_KLULA/98-168),(TF2B_DROME/120-190,(TF2B_KLULA/137-207,TF2B_YEAST/133-203))),TF2B_PYRWO/116-186),(TF3B_CANAL/190-263,TF3B_KLULA/193-266)));
ATL  7.69813
DNO  10
DLN  222
DID  0.416263
DPH  ((((((TF2B_KLULA/245-315:0.47781,TF2B_DROME/214-284:0.37844):0.13292,TF2B_HALVA/30-100:0.33553):0.17079,(TF3B_CANAL/190-263:0.24907,TF3B_KLULA/193-266:0.17408):0.35388):0.47701,(TF2B_KLULA/137-207:0.20879,TF2B_YEAST/133-203:0.20077):0.25755):0.16933,TF2B_DROME/120-190:0.35464):0.54611,TF3B_CANAL/95-165:0.25997,TF3B_KLULA/98-168:0.23780);
DTP  ((((((TF2B_KLULA/245-315,TF2B_DROME/214-284),TF2B_HALVA/30-100),(TF3B_CANAL/190-263,TF3B_KLULA/193-266)),(TF2B_KLULA/137-207,TF2B_YEAST/133-203)),TF2B_DROME/120-190),TF3B_CANAL/95-165,TF3B_KLULA/98-168);
DTL  4.98449
RID  0.283198
RPH  ((((TF2B_HALVA/30-100:0.37731,(TF2B_DROME/214-284:0.42056,TF2B_KLULA/245-315:0.63314):0.19166):0.46793,(TF3B_CANAL/190-263:0.31757,TF3B_KLULA/193-266:0.03524):0.64640):0.65594,(TF2B_DROME/120-190:0.37032,(TF2B_KLULA/137-207:0.16412,TF2B_YEAST/133-203:0.11616):0.64556):0.16265):1.18207,TF3B_CANAL/95-165:0.24291,TF3B_KLULA/98-168:0.14125);
RTP  ((((TF2B_HALVA/30-100,(TF2B_DROME/214-284,TF2B_KLULA/245-315)),(TF3B_CANAL/190-263,TF3B_KLULA/193-266)),(TF2B_DROME/120-190,(TF2B_KLULA/137-207,TF2B_YEAST/133-203))),TF3B_CANAL/95-165,TF3B_KLULA/98-168);
RTL  6.77071
LNK  TF2B_DROME/120-190:P29052:M88164
LNK  TF2B_DROME/214-284:P29052:M88164
LNK  TF2B_HALVA/30-100:P42198:Z35308
LNK  TF2B_KLULA/137-207:Q05959:L11606
LNK  TF2B_KLULA/245-315:Q05959:L11606
LNK  TF2B_PYRWO/116-186:P61999:
LNK  TF2B_PYRWO/212-282:P61999:
LNK  TF2B_YEAST/133-203:P29055:M81380
LNK  TF3B_CANAL/190-263:P43072:Z47202
LNK  TF3B_CANAL/95-165:P43072:Z47202
LNK  TF3B_KLULA/193-266:P46070:Z47203
LNK  TF3B_KLULA/98-168:P46070:Z47203
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TF3B_KLULA/193-266
ASQ  IQHFAEKLELGDKKIKVIRDAVKLAQTMSRDWMYEGRRPAGIAGACLLLACRMNNLRRTHSEIVAISHVAEETL
DSQ  ATTCAACATTTCGCGGAGAAATTGGAGCTTGGTGATAAAAAGATTAAAGTGATAAGGGACGCTGTGAAACTGGCACAAACTATGTCCAGAGATTGGATGTATGAAGGGAGAAGACCAGCTGGTATCGCAGGTGCATGTCTCTTACTTGCCTGTAGAATGAACAATTTGAGAAGAACGCATTCTGAAATCGTGGCAATATCTCATGTTGCAGAGGAAACGCTT
TRN  10010101100011010
NAM  TF3B_CANAL/190-263
ASQ  IQHFVEKLDFKDKATKVAKDAVKLAHRMAADWIHEGRRPAGIAGACVLLAARMNNFRRSHAEIVAVSHVGEETL
DSQ  ATACAACACTTTGTAGAGAAATTGGATTTTAAGGATAAGGCCACCAAAGTGGCGAAAGATGCTGTCAAATTAGCTCATAGAATGGCCGCTGATTGGATACACGAGGGAAGACGACCAGCAGGTATTGCTGGTGCGTGTGTGTTGTTGGCAGCAAGAATGAACAATTTCCGTAGGAGCCATGCCGAAATTGTTGCCGTGTCTCACGTTGGAGAAGAAACATTA
TRN  10010101110011010
NAM  TF2B_PYRWO/212-282
ASQ  VNKFADELGLSE---KVRRRAIEILDEAYKRGLTSGKSPAGLVAAALYIASLLEGEKRTQREVAEVARVTEVTV
NAM  TF2B_HALVA/30-100
ASQ  VPRFASELELSE---EVQSKANEIIDTTAEQGLLSGKSPTGYAAAAIYAASLLCNEKKTQREVADVAQVTEVTI
DSQ  GTCCCGCGGTTTGCCTCCGAACTGGAACTTTCTGAG---------GAAGTCCAGTCGAAGGCCAACGAAATCATCGACACCACCGCCGAGCAAGGGCTGCTCTCGGGGAAATCACCCACTGGCTACGCCGCCGCAGCCATCTACGCCGCTTCGCTGCTGTGTAACGAAAAGAAGACCCAGCGCGAGGTCGCTGACGTGGCTCAGGTGACAGAAGTCACCATC
TRN  11011101101011001
NAM  TF2B_KLULA/245-315
ASQ  IPRFCSHLGLSV---QVANAAEYIAKHSKDVNVLAGRSPITIAAAAIYMATLLFKLNISPTRISQTLQVTEGTV
DSQ  ATCCCTAGATTTTGTTCTCATTTGGGCCTTTCAGTG---------CAGGTGGCTAATGCTGCAGAGTACATCGCGAAACACTCTAAGGATGTCAATGTCTTGGCTGGTAGATCTCCTATCACCATCGCAGCAGCAGCTATCTATATGGCAACTCTACTATTCAAATTGAATATCAGTCCTACAAGAATCTCTCAGACTTTACAAGTCACAGAAGGTACCGTG
TRN  10010101110011000
NAM  TF2B_DROME/214-284
ASQ  MCRFCANLDLPN---MVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGVADVTI
DSQ  ATGTGCCGCTTCTGCGCCAACTTGGACCTGCCGAAC---------ATGGTCCAACGCGCTGCCACGCACATTGCAAAGAAAGCCGTCGAGATGGATATTGTACCGGGACGTTCGCCAATTTCTGTGGCCGCAGCCGCAATCTATATGGCCTCACAAGCATCCGAGCATAAGAGAAGCCAGAAGGAGATCGGTGATATAGCCGGTGTGGCCGACGTCACCATC
TRN  10010101100011001
NAM  TF2B_YEAST/133-203
ASQ  ITMLCDAAELPK---IVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEF
DSQ  ATTACCATGCTATGTGATGCTGCTGAATTACCGAAG---------ATTGTGAAAGATTGTGCCAAGGAAGCATATAAACTTTGCCACGATGAAAAAACTTTGAAGGGGAAATCAATGGAGAGTATAATGGCTGCATCCATACTGATTGGTTGCAGACGTGCTGAAGTGGCAAGGACTTTTAAAGAAATCCAGTCATTAATCCATGTCAAAACTAAAGAGTTT
TRN  10010101100011000
NAM  TF2B_KLULA/137-207
ASQ  ITMMCDAAELPK---IVKDCAKEAYKLCFEERVLKGKSQESIMASVILVGCRRAEVGRSFKEILSLTNVRKKEI
DSQ  ATTACTATGATGTGTGATGCTGCAGAACTGCCCAAG---------ATTGTTAAAGATTGTGCTAAAGAAGCTTATAAATTATGCTTCGAAGAGAGAGTCTTGAAGGGGAAATCACAGGAAAGTATCATGGCTTCAGTTATTCTTGTCGGATGTCGGAGAGCAGAGGTCGGGAGATCTTTCAAGGAAATCTTATCCTTGACTAACGTGCGGAAGAAGGAAATC
TRN  10010101100011000
NAM  TF2B_DROME/120-190
ASQ  ISSMADRINLPK---TIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEI
DSQ  ATATCCTCGATGGCCGATCGCATTAACTTGCCCAAA---------ACCATTGTCGATCGGGCCAACAACTTGTTCAAACAGGTTCATGATGGAAAGAACCTCAAGGGTCGTTCCAATGATGCCAAGGCATCCGCTTGTCTGTATATTGCTTGTCGCCAAGAAGGAGTTCCTCGCACATTCAAGGAAATATGTGCTGTCAGCAAGATCAGCAAAAAAGAGATT
TRN  10010101100011011
NAM  TF2B_PYRWO/116-186
ASQ  LDRITAQLKLPR---HVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVDKKEI
NAM  TF3B_KLULA/98-168
ASQ  LKAVSYALNIPE---YVTDAAFQWYRLALSNNFVQGRKSQNVIAACLYIACRKERTHHMLIDFSSRLQVSVYSI
DSQ  TTGAAAGCTGTCTCCTATGCGTTAAATATTCCCGAA---------TATGTTACTGATGCTGCTTTCCAATGGTATAGATTGGCTTTGAGTAATAATTTTGTTCAAGGTAGGAAATCACAAAATGTGATTGCCGCTTGTTTGTACATCGCATGTCGTAAAGAACGTACTCATCACATGCTTATTGACTTTTCATCAAGGTTACAAGTGAGTGTTTATTCTATT
TRN  10010101110011000
NAM  TF3B_CANAL/95-165
ASQ  IKRIAAALKIPD---YIAEAAGEWFRLALTLNFVQGRRSNNVLATCLYVACRKERTHHMLIDFSSRLQISVYSL
DSQ  ATTAAGAGAATTGCAGCTGCTTTAAAAATCCCTGAT---------TATATTGCCGAGGCTGCTGGAGAATGGTTCAGATTGGCGCTAACGTTGAATTTTGTCCAAGGAAGACGGTCTAATAACGTGTTGGCTACATGCTTGTATGTTGCTTGCCGTAAAGAAAGAACCCACCATATGTTGATTGACTTTAGTTCAAGATTGCAAATTTCTGTGTATTCACTA
TRN  10010101110011000
//