EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00367 - PTS_EIIB)
FAM  PF00367
PID  PTS_EIIB
DES  phosphotransferase system, EIIB
IPR  IPR001996
ANO  18
ALN  35
AID  0.463594
APH  (PTSB_VIBAL/7-41:0.18950,(PTSB_BACSU/7-41:0.11978,((((PTSA_PEDPE/7-40:0.07298,PTSA_LACLA/7-40:0.32210):0.17957,PTSA_STRMU/7-40:0.17090):0.09986,((((PTBA_ERWCH/7-41:0.20802,PTBA_BACSU/7-41:0.51092):0.23155,PTBA_ECOLI/5-39:0.16413):0.21425,(PTIB_ECOLI/73-107:0.51955,(PTOB_ECOLI/452-486:0.13801,((PTGA_STRPN/476-510:0.41267,PTAA_ECOLI/393-427:0.51764):0.22122,(PTGB_ECOLI/402-436:0.16152,(PTGA_BACSU/442-476:0.31018,PTGA_BACST/81-115:0.10770):0.25613):0.05961):0.22095):0.15261):0.31393):0.05238,PTDA_ECOLI/9-43:0.49437):0.16233):0.12046,PTSB_KLEPN/7-41:0.44216):0.01632):0.16900,SACX_BACSU/6-40:0.29414);
ATP  (PTSB_VIBAL/7-41,(PTSB_BACSU/7-41,((((PTSA_PEDPE/7-40,PTSA_LACLA/7-40),PTSA_STRMU/7-40),((((PTBA_ERWCH/7-41,PTBA_BACSU/7-41),PTBA_ECOLI/5-39),(PTIB_ECOLI/73-107,(PTOB_ECOLI/452-486,((PTGA_STRPN/476-510,PTAA_ECOLI/393-427),(PTGB_ECOLI/402-436,(PTGA_BACSU/442-476,PTGA_BACST/81-115)))))),PTDA_ECOLI/9-43)),PTSB_KLEPN/7-41)),SACX_BACSU/6-40);
ATL  7.62644
DNO  18
DLN  105
DID  0.50582
DPH  (((((((((PTSA_LACLA/7-40:0.34643,PTSA_PEDPE/7-40:0.10342):0.14505,PTSB_BACSU/7-41:0.23286):0.12209,PTSA_STRMU/7-40:0.27160):0.06226,PTSB_VIBAL/7-41:0.36238):0.06866,((PTBA_BACSU/7-41:0.26627,(PTBA_ECOLI/5-39:0.31290,PTBA_ERWCH/7-41:0.18005):0.09982):0.21112,SACX_BACSU/6-40:0.14704):0.11716):0.15291,(PTDA_ECOLI/9-43:0.30484,PTSB_KLEPN/7-41:0.35819):0.15174):0.11174,(PTOB_ECOLI/452-486:0.12575,PTIB_ECOLI/73-107:0.48281):0.15035):0.18994,PTGB_ECOLI/402-436:0.18861):0.09141,PTAA_ECOLI/393-427:0.41998,((PTGA_STRPN/476-510:0.39739,PTGA_BACSU/442-476:0.19417):0.17908,PTGA_BACST/81-115:0.25796):0.10089);
DTP  (((((((((PTSA_LACLA/7-40,PTSA_PEDPE/7-40),PTSB_BACSU/7-41),PTSA_STRMU/7-40),PTSB_VIBAL/7-41),((PTBA_BACSU/7-41,(PTBA_ECOLI/5-39,PTBA_ERWCH/7-41)),SACX_BACSU/6-40)),(PTDA_ECOLI/9-43,PTSB_KLEPN/7-41)),(PTOB_ECOLI/452-486,PTIB_ECOLI/73-107)),PTGB_ECOLI/402-436),PTAA_ECOLI/393-427,((PTGA_STRPN/476-510,PTGA_BACSU/442-476),PTGA_BACST/81-115));
DTL  6.90687
RID  0.463594
RPH  (PTSB_VIBAL/7-41:0.18950,(PTSB_BACSU/7-41:0.11978,((((PTSA_PEDPE/7-40:0.07298,PTSA_LACLA/7-40:0.32210):0.17957,PTSA_STRMU/7-40:0.17090):0.09986,((((PTBA_ERWCH/7-41:0.20802,PTBA_BACSU/7-41:0.51092):0.23155,PTBA_ECOLI/5-39:0.16413):0.21425,(PTIB_ECOLI/73-107:0.51955,(PTOB_ECOLI/452-486:0.13801,((PTGA_STRPN/476-510:0.41267,PTAA_ECOLI/393-427:0.51764):0.22122,(PTGB_ECOLI/402-436:0.16152,(PTGA_BACSU/442-476:0.31018,PTGA_BACST/81-115:0.10770):0.25613):0.05961):0.22095):0.15261):0.31393):0.05238,PTDA_ECOLI/9-43:0.49437):0.16233):0.12046,PTSB_KLEPN/7-41:0.44216):0.01632):0.16900,SACX_BACSU/6-40:0.29414);
RTP  (PTSB_VIBAL/7-41,(PTSB_BACSU/7-41,((((PTSA_PEDPE/7-40,PTSA_LACLA/7-40),PTSA_STRMU/7-40),((((PTBA_ERWCH/7-41,PTBA_BACSU/7-41),PTBA_ECOLI/5-39),(PTIB_ECOLI/73-107,(PTOB_ECOLI/452-486,((PTGA_STRPN/476-510,PTAA_ECOLI/393-427),(PTGB_ECOLI/402-436,(PTGA_BACSU/442-476,PTGA_BACST/81-115)))))),PTDA_ECOLI/9-43)),PTSB_KLEPN/7-41)),SACX_BACSU/6-40);
RTL  7.62644
LNK  PTAA_ECOLI/393-427:P09323:M19284
LNK  PTBA_BACSU/7-41:P40739:Z34526
LNK  PTBA_ECOLI/5-39:P08722:M15746
LNK  PTBA_ERWCH/7-41:P26207:M81772
LNK  PTDA_ECOLI/9-43:P24241:M73326
LNK  PTGA_BACST/81-115:P42015:U12340
LNK  PTGA_BACSU/442-476:P20166:Z11744
LNK  PTGA_STRPN/476-510:P35595:AE007383
LNK  PTGB_ECOLI/402-436:P05053:J02618
LNK  PTIB_ECOLI/73-107:P31451:L10328
LNK  PTOB_ECOLI/452-486:P19642:M60722
LNK  PTSA_LACLA/7-40:Q04938:M96669
LNK  PTSA_PEDPE/7-40:P43470:Z32771
LNK  PTSA_STRMU/7-40:P12655:M22711
LNK  PTSB_BACSU/7-41:P05306:J03006
LNK  PTSB_KLEPN/7-41:P27219:X57401
LNK  PTSB_VIBAL/7-41:P22825:M76768
LNK  SACX_BACSU/6-40:P15400:M29333
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SACX_BACSU/6-40
ASQ  AKELLLLAGGKNNIISISHCTTRLRFDVKDETKID
DSQ  GCAAAAGAATTACTGCTGCTCGCAGGAGGAAAAAACAATATTATCAGCATCAGCCATTGTACGACCCGTCTTCGTTTTGATGTAAAGGACGAGACGAAAATTGAT
TRN  11011101101011010
NAM  PTSB_VIBAL/7-41
ASQ  AKELLTLLGGKSNITALAHCATRLRLAVADEQKID
DSQ  GCAAAAGAGTTGTTAACTCTATTAGGTGGTAAAAGCAACATCACCGCACTTGCACATTGTGCGACACGCTTACGCCTTGCCGTTGCAGATGAGCAAAAAATAGAT
TRN  10010101110011010
NAM  PTSB_BACSU/7-41
ASQ  AKRLIELLGGKENIISAAHCATRLRLVMKDESKID
DSQ  GCAAAACGCCTCATTGAGCTTCTCGGAGGGAAAGAAAATATTATCAGCGCGGCTCATTGTGCAACAAGACTGCGTTTAGTGATGAAAGATGAATCAAAGATAGAT
TRN  10010101100011000
NAM  PTSA_PEDPE/7-40
ASQ  ADRVLNAIG-KNNIQAAAHCATRLRLVIKDESKID
DSQ  GCCGACCGCGTACTTAATGCAATTGGT---AAAAACAACATTCAAGCCGCCGCCCACTGTGCGACACGCCTCCGTTTGGTCATCAAGGATGAATCCAAGATTGAT
TRN  11011101111011011
NAM  PTSA_STRMU/7-40
ASQ  ASEVITAVG-KDNLVAAAHCATRLRLVLKDDSKVD
DSQ  GCTAGTGAAGTCATCACAGCTGTTGGT---AAAGATAATCTTGTAGCTGCCGCTCACTGTGCGACACGTCTTCGTCTTGTTTTAAAAGATGACAGTAAAGTAGAT
TRN  11011101111011010
NAM  PTSA_LACLA/7-40
ASQ  AERILNAVG-RDNIQGARHCATRLRLVLKDTGVID
DSQ  GCTGAACGCATTTTAAATGCAGTTGGG---CGTGATAACATTCAAGGAGCTCGACATTGTGCGACACGACTACGTTTAGTCCTAAAAGATACTGGCGTTATTGAT
TRN  11011101111011010
NAM  PTSB_KLEPN/7-41
ASQ  SRSLLPLLGGKENIASAAHCATRLRLVLVDDALAD
DSQ  TCCCGCTCACTGCTTCCCCTGCTGGGCGGCAAGGAAAATATCGCCAGCGCCGCGCACTGCGCCACCCGCCTGCGGCTGGTGCTGGTCGACGACGCGCTCGCCGAT
TRN  11011111101111101
NAM  PTDA_ECOLI/9-43
ASQ  ARSVIAALGGVDNISAVTHCMTRLRFVIKDDALID
DSQ  GCACGCTCGGTGATAGCGGCACTGGGCGGCGTTGATAACATCTCGGCGGTCACGCACTGTATGACGCGGTTGCGCTTTGTTATCAAAGATGATGCACTTATCGAC
TRN  10010101100011011
NAM  PTBA_ERWCH/7-41
ASQ  ASEIRDGVGGQENIISVIHCATRLRFKLRDNTNAN
DSQ  GCCAGTGAAATAAGAGATGGCGTAGGCGGTCAGGAAAATATTATTAGCGTGATACATTGCGCCACGCGCCTGCGGTTTAAACTCAGGGACAATACCAACGCCAAT
TRN  10010101100011011
NAM  PTBA_ECOLI/5-39
ASQ  ARKIVAGVGGADNIVSLMHCATRLRFKLKDESKAQ
DSQ  GCCAGAAAAATAGTCGCAGGAGTCGGGGGCGCAGATAACATTGTGAGTCTGATGCATTGCGCAACGCGATTACGTTTTAAATTAAAGGATGAAAGCAAAGCGCAA
TRN  10010101100011010
NAM  PTBA_BACSU/7-41
ASQ  SKDILQLVGGEENVQRVIHCMTRLRFNLHDNAKAD
DSQ  TCGAAGGACATATTACAACTCGTAGGCGGTGAAGAAAACGTTCAGCGCGTGATCCACTGCATGACGAGGCTGCGTTTTAATCTTCATGACAACGCGAAGGCGGAT
TRN  10010101100011010
NAM  PTIB_ECOLI/73-107
ASQ  AAGILQALGGVGNISSINNCATRLRIALHDMSQTL
DSQ  GCTGCCGGTATCCTGCAAGCCCTGGGCGGGGTCGGCAATATCTCCAGCATTAACAATTGCGCGACGCGTTTACGTATTGCACTGCATGACATGTCACAAACGCTG
TRN  11011111101111100
NAM  PTOB_ECOLI/452-486
ASQ  VPAILEALGGADNIVSLDNCITRLRLSVKDMSLVN
DSQ  GTTCCTGCAATCCTCGAAGCATTAGGCGGTGCCGACAATATTGTCAGCCTCGATAACTGCATTACCCGTCTGCGTTTGTCTGTGAAAGATATGTCGCTTGTTAAT
TRN  11011101101011010
NAM  PTGB_ECOLI/402-436
ASQ  APALVAAFGGKENITNLDACITRLRVSVADVSKVD
DSQ  GCACCGGCTCTGGTTGCTGCATTTGGTGGTAAAGAAAACATTACTAACCTCGACGCATGTATTACCCGTCTGCGCGTCAGCGTTGCTGATGTGTCTAAAGTGGAT
TRN  11011101101011011
NAM  PTGA_BACSU/442-476
ASQ  PYEILQAMGDQENIKHLDACITRLRVTVNDQKKVD
DSQ  CCTTATGAGATTCTGCAGGCAATGGGTGACCAGGAAAACATCAAACACCTTGATGCTTGTATCACTCGTCTGCGTGTGACTGTAAACGATCAGAAAAAGGTTGAT
TRN  11011101101011011
NAM  PTGA_BACST/81-115
ASQ  PYEVLAALGGKENIEHLDACITRLRVSVHDIGRVD
DSQ  CCGTACGAAGTGCTCGCCGCCCTTGGCGGAAAGGAAAACATCGAACATTTGGACGCATGCATTACGCGTTTGCGCGTTTCGGTCCATGATATCGGCCGGGTCGAT
TRN  11011111111111111
NAM  PTGA_STRPN/476-510
ASQ  AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVG
DSQ  GCTGTAAACATTATCAACCTTCTTGGTGGACGTGTAAACATCGTTGATGTTGATGCATGTATGACTCGTCTTCGTGTAACTGTTAAAGATGCAGATAAAGTAGGA
TRN  11011101111011011
NAM  PTAA_ECOLI/393-427
ASQ  ATNYIAAVGGTDNLKAIDACITRLRLTVADSARVN
DSQ  GCAACCAACTATATTGCTGCGGTTGGCGGCACTGACAACCTGAAAGCGATTGACGCCTGTATCACCCGTCTGCGCCTTACAGTGGCTGACTCTGCCCGCGTTAAC
TRN  11011101101011011
//