EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00323 - Defensin_1)
FAM  PF00323
PID  Defensin_1
DES  Mammalian defensin
IPR  IPR006081
ANO  11
ALN  30
AID  0.444143
APH  (DEF1A_CAVPO/65-93:0.59295,((DEF5_MOUSE/64-92:0.55149,DEF1_MOUSE/64-92:0.09968):0.39617,((((DEF4_HUMAN/65-93:0.84118,DEF2_RABIT/3-32:0.10204):0.28835,((DEF5_RABIT/65-93:0.08006,DEF6_HUMAN/72-99:0.67132):0.39693,DEF1_RABIT/62-90:0.37915):0.24593):0.20184,DEF3_RABIT/65-93:0.30033):0.42132,DEF5_HUMAN/65-93:0.35635):0.18801):0.33698,DEF3_HUMAN/66-94:0.30858);
ATP  (DEF1A_CAVPO/65-93,((DEF5_MOUSE/64-92,DEF1_MOUSE/64-92),((((DEF4_HUMAN/65-93,DEF2_RABIT/3-32),((DEF5_RABIT/65-93,DEF6_HUMAN/72-99),DEF1_RABIT/62-90)),DEF3_RABIT/65-93),DEF5_HUMAN/65-93)),DEF3_HUMAN/66-94);
ATL  6.75866
DNO  10
DLN  90
DID  0.54688
DPH  ((((DEF6_HUMAN/72-99:0.30654,(DEF1A_CAVPO/65-93:0.36044,DEF3_HUMAN/66-94:0.18087):0.04237):0.08607,(DEF3_RABIT/65-93:0.12407,((DEF1_RABIT/62-90:0.26752,DEF5_RABIT/65-93:0.16416):0.08692,DEF5_HUMAN/65-93:0.41998):0.12916):0.27523):0.06840,DEF4_HUMAN/65-93:0.26409):0.23331,DEF1_MOUSE/64-92:0.20188,DEF5_MOUSE/64-92:0.09128);
DTP  ((((DEF6_HUMAN/72-99,(DEF1A_CAVPO/65-93,DEF3_HUMAN/66-94)),(DEF3_RABIT/65-93,((DEF1_RABIT/62-90,DEF5_RABIT/65-93),DEF5_HUMAN/65-93))),DEF4_HUMAN/65-93),DEF1_MOUSE/64-92,DEF5_MOUSE/64-92);
DTL  3.30229
RID  0.443315
RPH  ((DEF3_RABIT/65-93:0.49190,(DEF5_HUMAN/65-93:0.41785,((DEF1_MOUSE/64-92:0.00770,DEF5_MOUSE/64-92:0.62413):0.45481,(DEF1A_CAVPO/65-93:0.55895,DEF3_HUMAN/66-94:0.33011):0.42637):0.00000):0.29957):0.26689,(DEF4_HUMAN/65-93:0.77484,(DEF5_RABIT/65-93:0.15991,DEF6_HUMAN/72-99:0.57046):0.22429):0.15093,DEF1_RABIT/62-90:0.31197);
RTP  ((DEF3_RABIT/65-93,(DEF5_HUMAN/65-93,((DEF1_MOUSE/64-92,DEF5_MOUSE/64-92),(DEF1A_CAVPO/65-93,DEF3_HUMAN/66-94)))),(DEF4_HUMAN/65-93,(DEF5_RABIT/65-93,DEF6_HUMAN/72-99)),DEF1_RABIT/62-90);
RTL  6.07068
LNK  DEF1A_CAVPO/65-93:P11478:D14119
LNK  DEF1_MOUSE/64-92:P11477:M33225
LNK  DEF1_RABIT/62-90:P07469:M64599
LNK  DEF2_RABIT/3-32:P07468:
LNK  DEF3_HUMAN/66-94:P59666:M23281
LNK  DEF3_RABIT/65-93:P01376:M28883
LNK  DEF4_HUMAN/65-93:P12838:U18745
LNK  DEF5_HUMAN/65-93:Q01523:M97925
LNK  DEF5_MOUSE/64-92:P28312:U12560
LNK  DEF5_RABIT/65-93:P07467:M64601
LNK  DEF6_HUMAN/72-99:Q01524:M98331
AMK  xxxxxx.xxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  DEF3_HUMAN/66-94
ASQ  CYCRIP.ACIAGERRYGTCIYQGRLWAFCC
DSQ  TGCTATTGCAGAATACCA...GCGTGCATTGCAGGAGAACGTCGCTATGGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCTGC
TRN  10010101110011011
NAM  DEF1A_CAVPO/65-93
ASQ  CICTTR.TCRFPYRRLGTCIFQNRVYTFCC
DSQ  TGTATTTGCACAACAAGA...ACCTGCCGTTTTCCATATCGCAGGCTGGGAACCTGCATCTTCCAGAATCGAGTCTACACATTCTGCTGC
TRN  10010101100011011
NAM  DEF5_MOUSE/64-92
ASQ  CYCRIR.GCKRRERVFGTCRNLFLTFVFCC
DSQ  TGCTATTGTAGAATAAGA...GGCTGCAAAAGAAGAGAACGCGTTTTTGGGACCTGCAGAAATCTTTTTTTAACTTTCGTATTCTGCTGT
TRN  10010101110011010
NAM  DEF1_MOUSE/64-92
ASQ  CYCRSR.GCKGRERMNGTCRKGHLLYTLCC
DSQ  TGCTATTGTAGATCAAGA...GGCTGCAAAGGAAGAGAACGCATGAATGGAACCTGCAGAAAGGGTCATTTATTGTACACGCTCTGCTGT
TRN  10010101110011000
NAM  DEF5_HUMAN/65-93
ASQ  CYCRTG.RCATRESLSGVCEISGRLYRLCC
DSQ  TGCTATTGCCGAACCGGC...CGTTGTGCTACCCGTGAGTCCCTCTCCGGGGTGTGTGAAATCAGTGGCCGCCTCTACAGACTCTGCTGT
TRN  10010101110011011
NAM  DEF6_HUMAN/72-99
ASQ  CHCRR-.SCYSTEYSYGTCTVMGINHRFCC
DSQ  TGCCATTGCAGAAGG---...TCCTGTTATTCAACAGAATATTCCTATGGGACCTGCACTGTCATGGGTATTAACCACAGATTCTGCTGC
TRN  10110101110011001
NAM  DEF5_RABIT/65-93
ASQ  CTCRRF.SCGFGERASGSCTVNGVRHTLCC
DSQ  TGTACTTGCAGACGATTC...AGTTGTGGGTTTGGGGAACGCGCCTCTGGGTCCTGCACAGTCAATGGAGTCCGCCACACACTCTGCTGC
TRN  10010101110011011
NAM  DEF1_RABIT/62-90
ASQ  CACRRR.FCPNSERFSGYCRVNGARYVRCC
DSQ  TGTGCTTGCAGAAGACGC...TTTTGCCCGAATTCTGAACGCTTTTCGGGGTACTGCAGAGTCAATGGAGCCCGCTATGTACGCTGTTGC
TRN  10110101110011011
NAM  DEF4_HUMAN/65-93
ASQ  CSCRLV.FCRRTELRVGNCLIGGVSFTYCC
DSQ  TGCTCTTGCAGATTAGTA...TTCTGCCGGCGAACAGAACTTCGTGTTGGGAACTGCCTCATTGGTGGTGTGAGTTTCACATACTGCTGC
TRN  10010101110011010
NAM  DEF3_RABIT/65-93
ASQ  CACRRA.LCLPRERRAGFCRIRGRIHPLCC
DSQ  TGTGCGTGCAGACGAGCC...CTCTGTTTGCCTCGGGAACGTCGTGCTGGGTTCTGCAGAATCCGTGGAAGAATCCACCCACTCTGCTGC
TRN  10010101110011011
NAM  DEF2_RABIT/3-32
ASQ  CVCRKQlLCSYRERRIGDCKIRGVRFPFCC
//