EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00273 - Serum_albumin)
FAM  PF00273
PID  Serum_albumin
DES  Serum albumin family
IPR  IPR000264
ANO  43
ALN  186
AID  0.285113
APH  ((((ALBU_PETMA/1235-1413:1.12600,(ALBU_PETMA/240-417:0.74255,(ALBU_PETMA/1041-1217:0.59215,O42279_PETMA/145-322:0.52657):0.19465):0.39088):0.34359,((VTDB_HUMAN/216-385:1.26506,VTDB_HUMAN/25-199:0.80621):0.14923,((ALBU1_SALSA/22-196:0.92604,(((((AFAM_HUMAN/28-202:0.05428,AFAM_MOUSE/28-202:0.34041):0.55122,((FETA_GORGO/28-202:0.15627,FETA_HORSE/28-202:0.14281):0.12666,(FETA_MOUSE/28-198:0.07523,FETA_RAT/34-204:0.16053):0.18133):0.43601):0.26392,(ALBU_CHICK/31-206:0.30069,(ALBU_MOUSE/28-202:0.12444,(ALBU_MERUN/29-203:0.16342,(((ALBU_PIG/28-201:0.12716,ALBU_BOVIN/28-201:0.13952):0.05219,(ALBU_HORSE/28-201:0.14134,(ALBU_FELCA/28-202:0.13681,ALBU_HUMAN/28-202:0.11169):0.02158):0.03498):0.09375,ALBU_RABIT/28-202:0.16744):0.05678):0.02451):0.36872):0.10106):0.16478,(ALBU1_XENLA/31-202:0.40128,Q9YGH6_9NEOB/29-201:0.97854):0.29793):0.12700,Q91134_NAJNA/31-206:0.68848):0.26954):0.27042,(ALBU1_SALSA/214-390:0.74700,((((AFAM_HUMAN/220-394:0.14539,AFAM_MOUSE/220-394:0.21008):0.46774,((FETA_MOUSE/216-390:0.27914,FETA_HORSE/220-394:0.16062):0.05036,FETA_GORGO/220-394:0.07356):0.37825):0.15015,(ALBU_CHICK/224-398:0.29893,(ALBU_RABIT/220-394:0.13811,((ALBU_MACMU/212-386:0.07345,(ALBU_HORSE/219-393:0.14799,ALBU_MOUSE/220-394:0.13662):0.03752):0.02545,ALBU_BOVIN/219-393:0.14782):0.05457):0.37141):0.09240):0.07830,(ALBU2_XENLA/219-393:0.49171,(ALBU_RANCA/2-170:0.08177,Q9YGH6_9NEOB/219-391:0.18671):0.39400):0.21910):0.24710):0.33089):0.17750):0.10524):1.00708,FETA_MOUSE/408-588:0.40634):0.39185,AFAM_HUMAN/412-590:0.10442,AFAM_MOUSE/412-590:0.37766);
ATP  ((((ALBU_PETMA/1235-1413,(ALBU_PETMA/240-417,(ALBU_PETMA/1041-1217,O42279_PETMA/145-322))),((VTDB_HUMAN/216-385,VTDB_HUMAN/25-199),((ALBU1_SALSA/22-196,(((((AFAM_HUMAN/28-202,AFAM_MOUSE/28-202),((FETA_GORGO/28-202,FETA_HORSE/28-202),(FETA_MOUSE/28-198,FETA_RAT/34-204))),(ALBU_CHICK/31-206,(ALBU_MOUSE/28-202,(ALBU_MERUN/29-203,(((ALBU_PIG/28-201,ALBU_BOVIN/28-201),(ALBU_HORSE/28-201,(ALBU_FELCA/28-202,ALBU_HUMAN/28-202))),ALBU_RABIT/28-202))))),(ALBU1_XENLA/31-202,Q9YGH6_9NEOB/29-201)),Q91134_NAJNA/31-206)),(ALBU1_SALSA/214-390,((((AFAM_HUMAN/220-394,AFAM_MOUSE/220-394),((FETA_MOUSE/216-390,FETA_HORSE/220-394),FETA_GORGO/220-394)),(ALBU_CHICK/224-398,(ALBU_RABIT/220-394,((ALBU_MACMU/212-386,(ALBU_HORSE/219-393,ALBU_MOUSE/220-394)),ALBU_BOVIN/219-393)))),(ALBU2_XENLA/219-393,(ALBU_RANCA/2-170,Q9YGH6_9NEOB/219-391))))))),FETA_MOUSE/408-588),AFAM_HUMAN/412-590,AFAM_MOUSE/412-590);
ATL  23.7893
DNO  43
DLN  558
DID  0.440764
DPH  (((((((((((ALBU_FELCA/28-202:0.11896,((ALBU_PIG/28-201:0.07451,ALBU_BOVIN/28-201:0.08876):0.02881,ALBU_HORSE/28-201:0.10423):0.02248):0.01666,ALBU_HUMAN/28-202:0.07654):0.04138,(ALBU_MERUN/29-203:0.11898,ALBU_MOUSE/28-202:0.10080):0.08052):0.02320,ALBU_RABIT/28-202:0.09158):0.16509,(ALBU_CHICK/31-206:0.18528,(((AFAM_HUMAN/28-202:0.07332,AFAM_MOUSE/28-202:0.21598):0.30420,((FETA_GORGO/28-202:0.08718,FETA_HORSE/28-202:0.07240):0.08694,(FETA_MOUSE/28-198:0.06405,FETA_RAT/34-204:0.08972):0.11399):0.30475):0.07624,Q91134_NAJNA/31-206:0.52983):0.13643):0.12427):0.15129,(ALBU1_XENLA/31-202:0.29784,Q9YGH6_9NEOB/29-201:0.49554):0.14969):0.22975,ALBU1_SALSA/22-196:0.50836):0.05024,((ALBU1_SALSA/214-390:0.53709,(((((AFAM_HUMAN/220-394:0.07758,AFAM_MOUSE/220-394:0.16759):0.24985,((FETA_MOUSE/216-390:0.19693,FETA_HORSE/220-394:0.08992):0.02315,FETA_GORGO/220-394:0.06176):0.28121):0.09439,ALBU_CHICK/224-398:0.20546):0.08203,((((ALBU_HORSE/219-393:0.08285,ALBU_MOUSE/220-394:0.15507):0.02770,ALBU_BOVIN/219-393:0.08905):0.01956,ALBU_MACMU/212-386:0.06129):0.04215,ALBU_RABIT/220-394:0.08461):0.21163):0.08161,(ALBU2_XENLA/219-393:0.29220,(ALBU_RANCA/2-170:0.07110,Q9YGH6_9NEOB/219-391:0.09080):0.29734):0.10821):0.18582):0.13486,VTDB_HUMAN/25-199:0.63896):0.06552):0.10668,((ALBU_PETMA/1235-1413:0.55127,(ALBU_PETMA/240-417:0.51625,(ALBU_PETMA/1041-1217:0.33439,O42279_PETMA/145-322:0.39024):0.17648):0.17893):0.18094,VTDB_HUMAN/216-385:0.79675):0.03354):0.43593,FETA_MOUSE/408-588:0.33272):0.17530,AFAM_HUMAN/412-590:0.08320,AFAM_MOUSE/412-590:0.22777);
DTP  (((((((((((ALBU_FELCA/28-202,((ALBU_PIG/28-201,ALBU_BOVIN/28-201),ALBU_HORSE/28-201)),ALBU_HUMAN/28-202),(ALBU_MERUN/29-203,ALBU_MOUSE/28-202)),ALBU_RABIT/28-202),(ALBU_CHICK/31-206,(((AFAM_HUMAN/28-202,AFAM_MOUSE/28-202),((FETA_GORGO/28-202,FETA_HORSE/28-202),(FETA_MOUSE/28-198,FETA_RAT/34-204))),Q91134_NAJNA/31-206))),(ALBU1_XENLA/31-202,Q9YGH6_9NEOB/29-201)),ALBU1_SALSA/22-196),((ALBU1_SALSA/214-390,(((((AFAM_HUMAN/220-394,AFAM_MOUSE/220-394),((FETA_MOUSE/216-390,FETA_HORSE/220-394),FETA_GORGO/220-394)),ALBU_CHICK/224-398),((((ALBU_HORSE/219-393,ALBU_MOUSE/220-394),ALBU_BOVIN/219-393),ALBU_MACMU/212-386),ALBU_RABIT/220-394)),(ALBU2_XENLA/219-393,(ALBU_RANCA/2-170,Q9YGH6_9NEOB/219-391)))),VTDB_HUMAN/25-199)),((ALBU_PETMA/1235-1413,(ALBU_PETMA/240-417,(ALBU_PETMA/1041-1217,O42279_PETMA/145-322))),VTDB_HUMAN/216-385)),FETA_MOUSE/408-588),AFAM_HUMAN/412-590,AFAM_MOUSE/412-590);
DTL  107.27
RID  0.285113
RPH  ((((ALBU_PETMA/1235-1413:1.12600,(ALBU_PETMA/240-417:0.74255,(ALBU_PETMA/1041-1217:0.59215,O42279_PETMA/145-322:0.52657):0.19465):0.39088):0.34359,((VTDB_HUMAN/216-385:1.26506,VTDB_HUMAN/25-199:0.80621):0.14923,((ALBU1_SALSA/22-196:0.92604,(((((AFAM_HUMAN/28-202:0.05428,AFAM_MOUSE/28-202:0.34041):0.55122,((FETA_GORGO/28-202:0.15627,FETA_HORSE/28-202:0.14281):0.12666,(FETA_MOUSE/28-198:0.07523,FETA_RAT/34-204:0.16053):0.18133):0.43601):0.26392,(ALBU_CHICK/31-206:0.30069,(ALBU_MOUSE/28-202:0.12444,(ALBU_MERUN/29-203:0.16342,(((ALBU_PIG/28-201:0.12716,ALBU_BOVIN/28-201:0.13952):0.05219,(ALBU_HORSE/28-201:0.14134,(ALBU_FELCA/28-202:0.13681,ALBU_HUMAN/28-202:0.11169):0.02158):0.03498):0.09375,ALBU_RABIT/28-202:0.16744):0.05678):0.02451):0.36872):0.10106):0.16478,(ALBU1_XENLA/31-202:0.40128,Q9YGH6_9NEOB/29-201:0.97854):0.29793):0.12700,Q91134_NAJNA/31-206:0.68848):0.26954):0.27042,(ALBU1_SALSA/214-390:0.74700,((((AFAM_HUMAN/220-394:0.14539,AFAM_MOUSE/220-394:0.21008):0.46774,((FETA_MOUSE/216-390:0.27914,FETA_HORSE/220-394:0.16062):0.05036,FETA_GORGO/220-394:0.07356):0.37825):0.15015,(ALBU_CHICK/224-398:0.29893,(ALBU_RABIT/220-394:0.13811,((ALBU_MACMU/212-386:0.07345,(ALBU_HORSE/219-393:0.14799,ALBU_MOUSE/220-394:0.13662):0.03752):0.02545,ALBU_BOVIN/219-393:0.14782):0.05457):0.37141):0.09240):0.07830,(ALBU2_XENLA/219-393:0.49171,(ALBU_RANCA/2-170:0.08177,Q9YGH6_9NEOB/219-391:0.18671):0.39400):0.21910):0.24710):0.33089):0.17750):0.10524):1.00708,FETA_MOUSE/408-588:0.40634):0.39185,AFAM_HUMAN/412-590:0.10442,AFAM_MOUSE/412-590:0.37766);
RTP  ((((ALBU_PETMA/1235-1413,(ALBU_PETMA/240-417,(ALBU_PETMA/1041-1217,O42279_PETMA/145-322))),((VTDB_HUMAN/216-385,VTDB_HUMAN/25-199),((ALBU1_SALSA/22-196,(((((AFAM_HUMAN/28-202,AFAM_MOUSE/28-202),((FETA_GORGO/28-202,FETA_HORSE/28-202),(FETA_MOUSE/28-198,FETA_RAT/34-204))),(ALBU_CHICK/31-206,(ALBU_MOUSE/28-202,(ALBU_MERUN/29-203,(((ALBU_PIG/28-201,ALBU_BOVIN/28-201),(ALBU_HORSE/28-201,(ALBU_FELCA/28-202,ALBU_HUMAN/28-202))),ALBU_RABIT/28-202))))),(ALBU1_XENLA/31-202,Q9YGH6_9NEOB/29-201)),Q91134_NAJNA/31-206)),(ALBU1_SALSA/214-390,((((AFAM_HUMAN/220-394,AFAM_MOUSE/220-394),((FETA_MOUSE/216-390,FETA_HORSE/220-394),FETA_GORGO/220-394)),(ALBU_CHICK/224-398,(ALBU_RABIT/220-394,((ALBU_MACMU/212-386,(ALBU_HORSE/219-393,ALBU_MOUSE/220-394)),ALBU_BOVIN/219-393)))),(ALBU2_XENLA/219-393,(ALBU_RANCA/2-170,Q9YGH6_9NEOB/219-391))))))),FETA_MOUSE/408-588),AFAM_HUMAN/412-590,AFAM_MOUSE/412-590);
RTL  23.7893
LNK  AFAM_HUMAN/220-394:P43652:L32140
LNK  AFAM_HUMAN/28-202:P43652:L32140
LNK  AFAM_HUMAN/412-590:P43652:L32140
LNK  AFAM_MOUSE/220-394:O89020:AJ011080
LNK  AFAM_MOUSE/28-202:O89020:AJ011080
LNK  AFAM_MOUSE/412-590:O89020:AJ011080
LNK  ALBU1_SALSA/214-390:P21848:X52397
LNK  ALBU1_SALSA/22-196:P21848:X52397
LNK  ALBU1_XENLA/31-202:P08759:M18350
LNK  ALBU2_XENLA/219-393:P14872:M21442
LNK  ALBU_BOVIN/219-393:P02769:M73993
LNK  ALBU_BOVIN/28-201:P02769:M73993
LNK  ALBU_CHICK/224-398:P19121:X60688
LNK  ALBU_CHICK/31-206:P19121:X60688
LNK  ALBU_FELCA/28-202:P49064:X84842
LNK  ALBU_HORSE/219-393:P35747:X74045
LNK  ALBU_HORSE/28-201:P35747:X74045
LNK  ALBU_HUMAN/28-202:P02768:M12523
LNK  ALBU_MACMU/212-386:Q28522:M90463
LNK  ALBU_MERUN/29-203:O35090:AB006197
LNK  ALBU_MOUSE/220-394:P07724:AJ011413
LNK  ALBU_MOUSE/28-202:P07724:AJ011413
LNK  ALBU_PETMA/1041-1217:Q91274:M74193
LNK  ALBU_PETMA/1235-1413:Q91274:M74193
LNK  ALBU_PETMA/240-417:Q91274:M74193
LNK  ALBU_PIG/28-201:P08835:AY663543
LNK  ALBU_RABIT/220-394:P49065:U18344
LNK  ALBU_RABIT/28-202:P49065:U18344
LNK  ALBU_RANCA/2-170:P21847:M38195
LNK  FETA_GORGO/220-394:P28050:M38272
LNK  FETA_GORGO/28-202:P28050:M38272
LNK  FETA_HORSE/220-394:P49066:U28947
LNK  FETA_HORSE/28-202:P49066:U28947
LNK  FETA_MOUSE/216-390:P02772:V00743
LNK  FETA_MOUSE/28-198:P02772:V00743
LNK  FETA_MOUSE/408-588:P02772:V00743
LNK  FETA_RAT/34-204:P02773:X02361
LNK  O42279_PETMA/145-322:O42279:AF031134
LNK  Q91134_NAJNA/31-206:Q91134:X78598
LNK  Q9YGH6_9NEOB/219-391:Q9YGH6:U40452
LNK  Q9YGH6_9NEOB/29-201:Q9YGH6:U40452
LNK  VTDB_HUMAN/216-385:P02774:L10641
LNK  VTDB_HUMAN/25-199:P02774:L10641
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxx
NAM  VTDB_HUMAN/216-385
ASQ  SNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESAS-..EDCMAKELPEHTVKLCDNLSTKN--SKFEDCCQEKTAMdVFVCTYFMPAAQLPELPDVEL-...-PTNKDVCD---PGNTKVMDKYTFELSRR-THLPEVFLSKVLEPTLKSLGECCD..VEDSTTCF
DSQ  TCAAATAGAGTCTGCTCACAATATGCTGCTTATGGGGAGAAGAAATCAAGGCTCAGCAATCTCATAAAGTTAGCCCAAAAAGTGCCTACTGCTGATCTGGAGGATGTTTTGCCACTAGCTGAAGATATTACTAACATCCTCTCCAAATGCTGTGAGTCTGCCTCT---......GAAGATTGCATGGCCAAAGAGCTGCCTGAACACACAGTAAAACTCTGTGACAATTTATCCACAAAGAAT------TCTAAGTTTGAAGACTGTTGTCAAGAAAAAACAGCCATGgacGTTTTTGTGTGCACTTACTTCATGCCAGCTGCCCAACTCCCCGAGCTTCCAGATGTAGAGTTG---.........---CCCACAAACAAAGATGTGTGTGAT---------CCAGGAAACACCAAAGTCATGGATAAGTATACATTTGAACTAAGCAGAAGG---ACTCATCTTCCGGAAGTATTCCTCAGTAAGGTACTTGAGCCAACCCTAAAAAGCCTTGGTGAATGCTGTGAT......GTTGAAGACTCAACTACCTGTTTT
TRN  10010101100011000
NAM  VTDB_HUMAN/25-199
ASQ  KNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGAD..PDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLE.RKLCMAALK----HQPQEFPTYv..EPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCT..SASPTVCF
DSQ  AAGAATAAAGTCTGCAAGGAATTCTCCCATCTGGGAAAGGAGGACTTCACATCTCTGTCACTAGTCCTGTACAGTAGAAAATTTCCCAGTGGCACGTTTGAACAGGTCAGCCAACTTGTGAAGGAAGTTGTCTCCTTGACCGAAGCCTGCTGTGCGGAAGGGGCTGAC......CCTGACTGCTATGACACCAGGACCTCAGCACTGTCTGCCAAGTCCTGTGAAAGTAATTCTCCATTCCCCGTTCACCCAGGCACTGCTGAGTGCTGCACCAAAGAGGGCCTGGAA...CGAAAGCTCTGCATGGCTGCTCTGAAA------------CACCAGCCACAGGAATTCCCTACCTACgtg......GAACCCACAAATGATGAAATCTGTGAGGCGTTCAGGAAAGATCCAAAGGAATATGCTAATCAATTTATGTGGGAATATTCCACTAATTACGGACAAGCTCCTCTGTCACTTTTAGTCAGTTACACCAAGAGTTATCTTTCTATGGTAGGGTCCTGCTGTACC......TCTGCAAGCCCAACTGTATGCTTT
TRN  10010101100011000
NAM  O42279_PETMA/145-322
ASQ  AAQLCSSLQALGAQKFLGRMVLVFSQRAPNATFDQISKLSHRFHSYAQTCCGEGWS..PGCFAEQRHLIHDEMCHDMEALSRVPAMAKCCQISGSA.RAKCMETIPRGKPVLDVALAR-...-FDGHKVCQMNAEAPQELLGRMLYEFGRRHTDASVGEAKKIITEWMDGVKDCCAgnHSEEQACL
DSQ  GCCGCTCAACTCTGCAGCTCTTTGCAGGCCTTGGGGGCTCAGAAATTCCTCGGCAGAATGGTTTTGGTGTTCTCACAGCGAGCCCCGAACGCGACCTTTGATCAGATCTCGAAGCTCAGCCATCGATTCCACAGCTACGCCCAGACCTGTTGTGGAGAGGGATGGTCA......CCCGGGTGCTTTGCTGAGCAGAGACATCTCATTCACGATGAGATGTGTCATGATATGGAGGCCCTGTCACGTGTTCCTGCTATGGCCAAATGTTGCCAAATCTCCGGCTCAGCC...CGGGCCAAATGCATGGAGACCATACCCAGGGGAAAGCCGGTCCTGGACGTGGCCCTGGCACGG---.........---TTCGACGGACACAAAGTTTGCCAGATGAACGCAGAGGCACCCCAAGAGTTGCTGGGCAGGATGCTTTACGAGTTCGGGAGGAGGCATACCGATGCATCCGTCGGTGAGGCAAAAAAAATCATCACGGAGTGGATGGACGGAGTGAAAGATTGTTGTGCTgggaatCATTCTGAGGAACAGGCATGTCTC
TRN  10010101100011001
NAM  ALBU_PETMA/1041-1217
ASQ  VQHICGSLHSRGEETFIQREVTLLSQKAPNASFEKVSQLARHFLSLAKKCCAPDHA..AGCFLEEPYAIHDEVCRDDEVVDQVGGLATCCRMSGTS.RAKCLAQLPRDLGRHGNRETP-...EFDELKICELRRDNPAVLMEKILYEFGRRHSDSAVSEVKNFAQKFSHSVTECCT..SEKTHECF
DSQ  GTGCAACACATTTGTGGGTCTCTGCATTCTCGTGGTGAAGAGACGTTTATTCAGAGAGAGGTCACTCTCCTCTCCCAGAAGGCCCCAAACGCCTCCTTTGAGAAAGTTTCTCAGCTGGCCCGACACTTCCTCAGCCTGGCTAAGAAATGTTGTGCACCAGATCATGCA......GCTGGGTGCTTCTTGGAGGAGCCGTACGCCATACACGATGAGGTGTGCCGTGACGACGAGGTGGTGGATCAAGTTGGGGGCCTGGCCACGTGCTGTCGAATGAGTGGAACCTCG...CGGGCCAAGTGCCTGGCACAGCTACCCAGGGATCTGGGTCGGCACGGGAACAGGGAGACGCCG---.........GAGTTTGACGAGCTGAAGATCTGCGAGTTGAGGAGGGATAACCCAGCTGTTCTGATGGAGAAGATTCTCTATGAGTTTGGTAGGAGACATTCTGACTCTGCCGTCAGCGAAGTGAAAAATTTCGCCCAGAAATTCTCTCACTCAGTGACGGAATGCTGCACT......TCAGAAAAGACTCACGAATGCTTC
TRN  10010101100011001
NAM  ALBU_PETMA/240-417
ASQ  SQNLCKALKSLGKEKFEDRIIVRFTQRAPQAPFELIQKLAHRFEVLAEKCCELGHS..DRCLVEERYTVDDELCLEQSFVATCPRLSSCCSLSGSS.RAQCLETVPVLETSDKASPATP...TLPISEQCTLWAGKPVEFHKRVVWQISHRYPTTGVAQVEALAHHYLEHLTICCA..SEDKDTCI
DSQ  AGTCAAAATTTGTGCAAGGCTCTGAAATCTCTTGGGAAGGAAAAATTCGAAGACAGGATCATTGTGAGGTTCACCCAAAGGGCTCCTCAGGCTCCATTCGAGCTGATCCAGAAGCTTGCTCACCGCTTCGAGGTCCTTGCAGAGAAATGTTGCGAGCTGGGTCACTCA......GATCGGTGTCTAGTGGAGGAGCGCTACACGGTTGATGATGAGCTTTGCTTGGAGCAGTCTTTCGTCGCGACCTGCCCAAGGCTGTCCTCCTGCTGTTCGCTGAGCGGAAGTAGC...CGTGCACAGTGCCTCGAGACTGTGCCCGTGCTCGAAACGTCGGACAAGGCCTCCCCGGCCACCCCA.........ACGCTTCCGATATCGGAGCAGTGCACTCTGTGGGCTGGGAAACCCGTCGAGTTTCACAAGCGAGTGGTTTGGCAAATCTCCCACCGCTATCCCACCACGGGAGTGGCCCAGGTCGAGGCTCTGGCTCACCACTATCTGGAACATCTTACCATTTGCTGTGCA......AGCGAGGACAAAGATACCTGCATA
TRN  10010101100011001
NAM  ALBU_PETMA/1235-1413
ASQ  GNLTCQRLKAQGVEHFEQLVILNFARAAKSLPMEKVVEFAHRFTRIAGQCCEHDT-..-HCLIDESFHLHAEMCGDHGYIMAHPGVANCCKSDVSE.QGTCFKIHEDVHHAEEILSKDVspaHPTAERVCLRYRQFPEKFINLALFELVHRLPLLESSVLRRKALAYTGFTDDCCR..AVDKTACF
DSQ  GGCAATTTGACTTGCCAGCGTCTTAAAGCTCAAGGCGTGGAACACTTTGAACAGCTAGTCATTCTCAACTTCGCCCGCGCTGCAAAAAGTCTGCCCATGGAGAAGGTCGTTGAATTTGCCCATCGGTTCACCCGCATCGCTGGGCAATGTTGTGAACACGACACT---......---CACTGTCTAATTGATGAGTCTTTTCACCTCCACGCCGAGATGTGCGGTGATCACGGCTACATAATGGCTCACCCAGGCGTGGCCAACTGCTGCAAGTCCGACGTTTCGGAG...CAGGGGACCTGCTTCAAGATCCACGAGGACGTCCACCACGCTGAGGAGATTTTGTCCAAGGATGTCagtcctgcaCATCCAACAGCGGAGAGAGTCTGCCTCCGATACAGACAATTTCCAGAGAAGTTTATTAACCTGGCTCTTTTCGAGTTGGTTCACCGCCTACCCTTGCTGGAGTCCTCAGTACTGAGGCGCAAAGCCTTGGCCTACACTGGATTCACAGATGACTGTTGTAGG......GCAGTGGACAAGACTGCCTGCTTC
TRN  10010101100011001
NAM  Q9YGH6_9NEOB/219-391
ASQ  HKQKCRVLKEFPERVSQALTLVQVSQRFGNAKYDDVEKVTIEIAHLNEDCCKGDA-..VECMIERME-ATEHICLAKEKLS--SKLSDCCAKGVLE.RTPCILALPNE--EPDLPIELKe..YYEDEHVCENYQKDKRKYLAHFTHDYSRSHQESSPQSCLRVSRGFEMLLEKCCA..SANSAECL
DSQ  CATAAACAGAAATGCCGTGTTCTTAAAGAATTTCCAGAAAGAGTTTCTCAAGCACTAACACTAGTTCAAGTATCCCAAAGGTTTGGTAATGCAAAATATGACGATGTGGAAAAAGTCACCATTGAAATTGCACATTTGAATGAAGATTGTTGCAAAGGTGATGCC---......GTGGAATGTATGATTGAAAGGATGGAA---GCAACGGAACATATTTGTTTAGCTAAGGAGAAATTATCA------AGCAAACTAAGTGACTGTTGTGCTAAAGGTGTTTTAGAA...CGAACACCCTGTATTCTTGCCCTACCAAACGAG------GAACCTGACTTGCCCATAGAACTGAAAgaa......TATTATGAAGATGAACATGTTTGTGAGAACTATCAAAAAGACAAGAGAAAATACCTTGCCCACTTTACGCATGATTATTCCAGAAGTCACCAGGAATCATCTCCTCAATCGTGTTTACGAGTTTCTAGAGGATTTGAAATGCTGCTGGAAAAGTGCTGTGCT......AGTGCAAACTCTGCTGAGTGTCTC
TRN  10010101100011000
NAM  ALBU_RANCA/2-170
ASQ  ----CRIIREFPDIVFKGLTLVQVSQKFGKAGFEDVKKVTEEIVHLNEDCCKGDA-..VECMMERME-ATDHICEAKDKLS--SKLADCCAKSILE.RTPCLLALPND--ESDLSKELKn..YYEDERVCENYKKDKLLFLAHFTHDYARSHQESSPQSCLRVSKGFEGLLEKCCA..SENHAECL
DSQ  ------------TGTCGTATTATTAGAGAATTTCCAGATATAGTTTTTAAAGGACTAACACTAGTTCAAGTCTCCCAAAAGTTTGGTAAGGCAGGGTTTGAAGATGTGAAAAAAGTCACCGAGGAAATTGTACATTTGAATGAAGACTGTTGCAAAGGTGATGCT---......GTGGAATGTATGATGGAAAGGATGGAA---GCCACCGATCATATTTGTGAGGCTAAGGACAAATTATCA------TCCAAACTAGCTGACTGCTGTGCTAAAAGTATTCTAGAG...CGAACACCCTGTCTTCTTGCCCTGCCAAACGAT------GAATCTGACTTGTCCAAAGAACTGAAAaat......TATTATGAAGATGAACGTGTGTGTGAGAACTATAAAAAAGACAAGTTATTATTCCTTGCCCACTTTACACACGATTATGCCAGAAGCCACCAGGAATCATCACCTCAGTCTTGTCTACGAGTTTCTAAAGGATTTGAAGGGTTGCTCGAAAAGTGCTGTGCT......AGTGAAAACCATGCCGAGTGTCTC
TRN  10010101100011000
NAM  ALBU2_XENLA/219-393
ASQ  QHHFCWILDNFPEKVLKALNLARVSHRYPKAEFKLAHNFTEEVTHFIKDCCHDDM-..FECMTERLE-LTEHTCQHKDELS--SKLEKCCNIPLLE.RTYCIVTLENDDVPAELSQPITe..FTEDPHVCEKYAENNEVFLGRYLHAVSRKHQELSEQFLLQSAKEYESLLNKCCK..TDNPPECY
DSQ  CAACATCATTTCTGCTGGATTCTGGATAATTTTCCTGAAAAAGTTCTTAAAGCACTAAATTTGGCCAGAGTGAGCCACAGATATCCTAAAGCTGAATTCAAGCTTGCCCATAATTTTACTGAGGAGGTTACACACTTTATTAAAGATTGTTGCCATGACGACATG---......TTTGAATGCATGACTGAGAGGCTGGAG---CTTACTGAGCATACCTGTCAACATAAAGATGAGTTATCA------TCAAAACTTGAAAAATGCTGTAATATACCTTTGCTTGAG...CGTACATACTGCATTGTCACCTTGGAAAATGATGACGTTCCTGCTGAATTGTCTCAGCCAATTACAgaa......TTTACAGAGGACCCTCATGTGTGTGAGAAGTATGCTGAGAATAACGAAGTTTTCTTAGGAAGATATCTCCATGCTGTGTCAAGAAAACACCAGGAATTGTCTGAACAATTCCTTTTGCAATCTGCAAAAGAATATGAATCTTTGCTGAACAAGTGCTGCAAA......ACAGACAATCCTCCTGAATGCTAC
TRN  10010101100011000
NAM  FETA_MOUSE/216-390
ASQ  NEHVCSVIRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNS-..LECLQDGEK-VMTYICSQQNILS--SKIAECCKLPMIQ.LGFCIIHAENGVKPEGLSLNPSq..FLGDRNFAQFSSEEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQ..SGNLPGCQ
DSQ  AATGAGCATGTATGTTCAGTGATAAGAAAATTTGGATCCCGAAACCTCCAGGCAACAACCATTATTAAGCTAAGTCAAAAGTTAACTGAAGCAAATTTTACTGAGATTCAGAAGCTGGCCCTGGATGTGGCTCACATCCACGAGGAGTGTTGCCAAGGAAACTCG---......CTGGAGTGTCTGCAGGATGGGGAAAAA---GTCATGACATATATATGTTCTCAACAAAATATTCTGTCA------AGCAAAATAGCAGAGTGCTGCAAATTACCCATGATCCAA...CTAGGCTTCTGCATAATTCACGCAGAGAATGGCGTCAAACCTGAAGGCTTATCTCTAAATCCAAGCcag......TTTTTGGGAGACAGAAATTTTGCCCAATTTTCTTCAGAGGAAAAAATCATGTTCATGGCAAGCTTTCTTCATGAATACTCAAGAACTCACCCCAACCTTCCTGTCTCAGTCATTCTAAGAATTGCTAAAACGTACCAGGAAATATTGGAGAAGTGTTCCCAG......TCTGGAAATCTACCTGGATGTCAG
TRN  10010101100011000
NAM  FETA_HORSE/220-394
ASQ  NQHVCAVIRNFGPRTLQAITVTTLSQRYSKANFTEIQKLVLDVAHAHEECCRGNV-..EECVQDGEK-LISYVCSQEDILS--SSIVECCKLPTVE.LAQCIIHAENDDKPEGLSPNLNr..LLGERDFNQFSSKEKDLFMARFTYEYSRRHTKLAVPVILRVAKGYQEFLEKCSQ..SENPLECQ
DSQ  AATCAACATGTGTGTGCAGTGATAAGAAATTTTGGACCCCGAACTCTCCAAGCTATAACGGTTACCACACTGAGTCAAAGGTATTCCAAGGCTAATTTTACTGAAATTCAGAAGCTAGTCCTGGATGTGGCCCACGCACATGAGGAATGTTGCAGGGGAAACGTG---......GAGGAGTGTGTGCAGGATGGGGAAAAA---CTTATATCCTATGTATGTTCTCAAGAAGATATTCTGTCA------AGCAGCATAGTCGAATGCTGTAAATTGCCCACAGTTGAA...CTTGCTCAATGCATAATTCATGCTGAAAATGATGACAAACCTGAAGGCTTATCTCCAAACCTAAATaga......CTTTTAGGAGAGAGAGATTTCAACCAGTTTTCTTCAAAGGAAAAAGATCTCTTCATGGCCAGATTTACTTATGAATATTCAAGAAGGCATACTAAGCTTGCTGTCCCAGTAATTCTAAGAGTTGCTAAAGGATACCAGGAGTTCTTGGAGAAGTGTTCCCAG......TCTGAAAACCCTCTTGAATGCCAG
TRN  10010101100011000
NAM  FETA_GORGO/220-394
ASQ  NQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDV-..LDCLQDGEK-IMSYICSQQDTLS--NKITECCKLTTLE.RGQCIIHAENDEKPEGLSPNLNr..FLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQ..TENPLECQ
DSQ  AATCAACATGCATGTGCAGTAATGAAAAATTTTGGGACCCGAACTTTCCAAGCCATAACTGTTACTAAACTGAGTCAGAAGTTTACCAAAGTTAATTTTACTGAAATCCAGAAACTAGTCCTGGATGTGGCCCACGTACATGAGCACTGTTGCAGAGGAGATGTG---......CTGGATTGTCTGCAGGATGGGGAAAAA---ATTATGTCCTACATATGTTCTCAACAAGACACTCTGTCA------AACAAAATAACAGAATGCTGCAAACTGACCACACTGGAA...CGTGGTCAATGTATAATTCATGCAGAAAATGATGAAAAACCTGAAGGTCTATCTCCAAATCTAAACagg......TTTTTAGGAGATAGAGATTTTAACCAATTTTCTTCAGGGGAAAAAAATATCTTCTTGGCAAGTTTTGTTCATGAATATTCAAGAAGACATCCTCAGCTTGCTGTCTCAGTAATTCTAAGAGTTGCTAAAGGATACCAGGAGTTATTGGAGAAGTGTTTCCAG......ACCGAAAACCCTCTTGAATGCCAA
TRN  10010101100011000
NAM  ALBU_MOUSE/220-394
ASQ  QRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDL-..LECADDRAE-LAKYMCENQATIS--SKLQTCCDKPLLK.KAHCLSEVEHDTMPADLPAIAAd..FVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCA..EANPPACY
DSQ  CAGAGAATGAAGTGCTCCAGTATGCAGAAGTTTGGAGAGAGAGCTTTTAAAGCATGGGCAGTAGCTCGTCTGAGCCAGACATTCCCCAATGCTGACTTTGCAGAAATCACCAAATTGGCAACAGACCTGACCAAAGTCAACAAGGAGTGCTGCCATGGTGACCTG---......CTGGAATGCGCAGATGACAGGGCGGAA---CTTGCCAAGTACATGTGTGAAAACCAGGCGACTATCTCC------AGCAAACTGCAGACTTGCTGCGATAAACCACTGTTGAAG...AAAGCCCACTGTCTTAGTGAGGTGGAGCATGACACCATGCCTGCTGATCTGCCTGCCATTGCTGCTgat......TTTGTTGAGGACCAGGAAGTGTGCAAGAACTATGCTGAGGCCAAGGATGTCTTCCTGGGCACGTTCTTGTATGAATATTCAAGAAGACACCCTGATTACTCTGTATCCCTGTTGCTGAGACTTGCTAAGAAATATGAAGCCACTCTGGAAAAGTGCTGCGCT......GAAGCCAATCCTCCCGCATGCTAC
TRN  10010101100011001
NAM  ALBU_MACMU/212-386
ASQ  QRLKCASLQKFGDRAFKAWAVARLSQKFPKAEFAEVSKLVTDLTKVHTECCHGDL-..LECADDRAD-LAKYMCENQDSIS--SKLKECCDKPLLE.KSHCLAEVENDEMPADLPSLAAd..YVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVMLLLRLAKAYEATLEKCCA..AADPHECY
DSQ  CAGAGACTCAAGTGTGCCAGTCTCCAAAAATTCGGAGACAGAGCTTTCAAAGCATGGGCAGTAGCTCGCTTGAGCCAGAAATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTG---......CTTGAATGTGCTGATGACAGGGCGGAC---CTTGCCAAGTATATGTGTGAAAATCAAGATTCAATCTCC------AGTAAACTGAAGGAATGCTGTGATAAACCTCTGTTGGAA...AAATCCCACTGCCTTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTgat......TATGTTGAGAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCATGCTGCTGCTGAGACTTGCCAAGGCATACGAAGCCACTCTAGAGAAGTGCTGTGCC......GCTGCAGATCCTCATGAATGCTAT
TRN  10010101100011000
NAM  ALBU_BOVIN/219-393
ASQ  QRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDL-..LECADDRAD-LAKYICDNQDTIS--SKLKECCDKPLLE.KSHCIAEVEKDAIPENLPPLTAd..FAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCA..KDDPHACY
DSQ  CAGAGACTCAGGTGTGCCAGTATTCAAAAATTTGGAGAAAGAGCTTTAAAAGCATGGTCAGTAGCTCGCCTGAGCCAGAAATTTCCCAAGGCTGAGTTTGTAGAAGTTACCAAGCTAGTGACAGATCTCACAAAAGTCCACAAGGAATGCTGCCATGGTGACCTA---......CTTGAATGCGCAGATGACAGGGCAGAT---CTTGCCAAGTACATATGTGATAATCAAGATACAATCTCC------AGTAAACTGAAGGAATGCTGTGATAAGCCTTTGTTGGAA...AAATCCCACTGCATTGCTGAGGTAGAAAAAGATGCCATACCTGAAAACCTGCCCCCATTAACTGCTgac......TTTGCTGAAGATAAGGATGTTTGCAAAAACTATCAGGAAGCAAAAGATGCCTTCCTGGGCTCGTTTTTGTATGAATATTCAAGAAGGCATCCTGAATATGCTGTCTCAGTGCTATTGAGACTTGCCAAGGAATATGAAGCCACACTGGAGGAATGCTGTGCC......AAAGATGATCCACATGCATGCTAT
TRN  10010101100011000
NAM  ALBU_HORSE/219-393
ASQ  ERLKCSSFQNFGERAVKAWSVARLSQKFPKADFAEVSKIVTDLTKVHKECCHGDL-..LECADDRAD-LAKYICEHQDSIS--GKLKACCDKPLLQ.KSHCIAEVKEDDLPSDLPALAAd..FAEDKEICKHYKDAKDVFLGTFLYEYSRRHPDYSVSLLLRIAKTYEATLEKCCA..EADPPACY
DSQ  GAGAGACTCAAGTGCTCCAGTTTCCAAAATTTTGGGGAGAGAGCTGTCAAAGCATGGTCAGTAGCTCGCCTGAGCCAGAAATTTCCCAAGGCTGACTTTGCAGAGGTTTCCAAGATAGTGACAGATCTTACCAAAGTCCACAAGGAATGCTGCCACGGTGACCTG---......CTTGAATGTGCCGATGACAGGGCGGAT---CTTGCCAAGTACATATGTGAACATCAAGATTCAATCTCT------GGCAAACTGAAAGCATGCTGTGATAAACCTTTGTTGCAA...AAATCCCACTGCATTGCCGAGGTGAAAGAAGATGACCTGCCTAGTGACCTGCCTGCATTAGCTGCTgat......TTTGCTGAAGATAAGGAAATCTGCAAACACTATAAGGATGCCAAAGATGTCTTCCTGGGCACGTTTTTGTATGAATACTCAAGAAGGCATCCTGATTACTCCGTCTCCTTGCTGTTGAGAATTGCCAAGACATATGAAGCCACGCTGGAGAAGTGCTGTGCG......GAGGCCGACCCTCCTGCGTGCTAC
TRN  10010101100011000
NAM  ALBU_RABIT/220-394
ASQ  ERLRCASIQKFGDRAYKAWALVRLSQRFPKADFTDISKIVTDLTKVHKECCHGDL-..LECADDRAD-LAKYMCEHQETIS--SHLKECCDKPILE.KAHCIYGLHNDETPAGLPAVAEe..FVEDKDVCKNYEEAKDLFLGKFLYEYSRRHPDYSVVLLLRLGKAYEATLKKCCA..TDDPHACY
DSQ  GAGAGACTCAGGTGTGCCAGTATTCAGAAATTTGGAGACAGAGCTTACAAAGCATGGGCACTTGTTCGTCTGAGCCAAAGATTTCCCAAGGCTGACTTCACAGACATTTCCAAGATAGTGACAGATCTCACCAAAGTCCACAAGGAATGCTGCCACGGTGACCTG---......CTTGAATGTGCAGATGACAGGGCGGAC---CTTGCCAAGTACATGTGTGAACATCAGGAAACAATCTCC------AGTCATCTGAAGGAATGCTGTGATAAGCCAATATTGGAA...AAAGCCCACTGCATTTATGGTTTGCATAATGATGAGACACCTGCTGGCTTGCCAGCAGTAGCTGAGgaa......TTTGTTGAGGATAAGGATGTTTGCAAAAATTATGAAGAGGCAAAAGATCTCTTCTTGGGCAAGTTTTTGTATGAGTATTCAAGAAGGCACCCTGATTACTCTGTCGTTCTGCTGCTGAGACTTGGCAAGGCCTATGAAGCCACCCTGAAAAAGTGCTGTGCC......ACTGATGACCCTCACGCATGCTAT
TRN  10010101100011001
NAM  ALBU_CHICK/224-398
ASQ  QQYFCGILKQFGDRVFQARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDM-..VECMDDMAR-MMSNLCSQQDVFS--GKIKDCCEKPIVE.RSQCIMEAEFDEKPADLPSLVEk..YIEDKEVCKSFEAGHDAFMAEFVYEYSRRHPEFSIQLIMRIAKGYESLLEKCCK..TDNPAECY
DSQ  CAGCAGTATTTTTGTGGAATCTTGAAGCAGTTCGGAGATAGAGTTTTCCAAGCACGACAACTTATTTACCTAAGCCAAAAATACCCCAAGGCTCCATTCTCAGAGGTTTCTAAATTTGTACATGATTCTATCGGCGTCCACAAAGAGTGCTGTGAAGGGGACATG---......GTGGAGTGCATGGATGACATGGCACGT---ATGATGAGCAATCTGTGCTCTCAACAAGATGTTTTCTCA------GGTAAAATCAAAGACTGCTGTGAGAAGCCTATTGTGGAA...CGAAGCCAGTGCATTATGGAGGCAGAATTTGATGAGAAACCTGCAGATCTGCCTTCATTAGTTGAAaag......TACATAGAAGATAAGGAAGTGTGTAAAAGTTTTGAAGCAGGCCACGATGCATTCATGGCAGAGTTCGTTTATGAATACTCACGAAGACACCCTGAGTTCTCCATACAGCTTATTATGAGAATTGCCAAAGGATATGAATCACTTCTGGAAAAGTGCTGCAAA......ACTGATAACCCTGCTGAGTGCTAC
TRN  10010101100011000
NAM  AFAM_MOUSE/220-394
ASQ  QRNVCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDV-..VHCIRSQSQ-VENHICSKQDSIS--SKIKVCCEKKTLE.REACIINANKDDRPEGLSLREAk..FTESENVCQERDSDPDKFFAEFIYEYSRRHPDLSTPRLLRITKVYMDFLEDCCS..RENPAGCY
DSQ  CAAAGAAATGTTTGTGGAGCCCTTATAAAGTTTGGACCCAAGGTCTTAAACTCTATAAACGTTGCTGTATTCAGTAAAAAATTCCCCAAGATTGGATTTAAGGACCTTACCACCCTCTTAGAAGATGTTTCTTCCATGTATGAAGGATGCTGTGAAGGAGATGTT---......GTGCACTGCATCCGAAGCCAGAGCCAG---GTTGAGAACCATATTTGTTCAAAACAAGATTCCATCTCA------AGTAAAATCAAAGTGTGCTGCGAAAAGAAGACCCTAGAA...CGTGAAGCCTGTATAATTAATGCAAATAAAGACGACAGACCGGAGGGCTTATCTCTCAGAGAAGCCaaa......TTCACTGAGAGCGAAAATGTGTGTCAAGAACGAGATTCTGACCCGGACAAGTTCTTTGCTGAGTTTATTTATGAATACTCCAGGAGACATCCTGACCTGTCTACACCAAGGCTCCTAAGAATTACTAAAGTGTATATGGACTTCTTAGAAGACTGCTGCAGC......AGAGAAAACCCAGCAGGTTGTTAC
TRN  10010101100011000
NAM  AFAM_HUMAN/220-394
ASQ  QKHVCGALLKFGTKVVHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEGDV-..VQCIRDTSK-VMNHICSKQDSIS--SKIKECCEKKIPE.RGQCIINSNKDDRPKDLSLREGk..FTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCN..TENPPGCY
DSQ  CAAAAACATGTCTGTGGGGCACTTTTGAAATTTGGAACCAAAGTTGTACACTTTATATATATTGCGATACTCAGTCAAAAATTCCCCAAGATTGAATTTAAGGAGCTTATTTCTCTTGTAGAAGATGTTTCTTCCAACTATGATGGATGCTGTGAAGGGGATGTT---......GTGCAGTGCATCCGTGACACGAGCAAG---GTTATGAACCATATTTGTTCAAAACAAGATTCTATCTCC------AGCAAAATCAAAGAGTGCTGTGAAAAGAAAATACCAGAG...CGCGGCCAGTGCATAATTAACTCAAACAAAGATGATAGACCAAAGGATTTATCTCTAAGAGAAGGAaaa......TTTACTGACAGTGAAAATGTGTGTCAAGAACGAGATGCTGACCCAGACACCTTCTTTGCGAAGTTTACTTTTGAATACTCAAGGAGACATCCAGACCTGTCTATACCAGAGCTTTTAAGAATTGTTCAAATATACAAAGATCTCCTGAGAAATTGCTGCAAC......ACAGAAAACCCTCCAGGTTGTTAC
TRN  10010101100011000
NAM  ALBU1_SALSA/214-390
ASQ  LRSLCIVHKKYGDRVVKAKKLVQYSQKMPQASFQEMGGMVDKIVATVAPCCSGDM-..VTCMKERKT-LVDEVCADESVLSRAAGLSACCKEDAVH.RGSCVEAMKPDPKPDGLSEHYDi..HADIAAVCQTFTKTPDVAMGKLVYEISVRHPESSQQVILRFAKEAEQALLQCCD..MEDHAECV
DSQ  CTCAGGTCCCTGTGCATCGTCCACAAGAAATATGGAGACCGCGTTGTCAAGGCCAAGAAGCTGGTTCAGTACAGTCAGAAGATGCCTCAGGCCTCTTTCCAGGAGATGGGAGGCATGGTAGACAAGATCGTAGCGACTGTTGCCCCCTGCTGCAGCGGAGACATG---......GTCACATGCATGAAGGAGAGGAAGACC---CTGGTGGATGAGGTGTGTGCTGATGAGAGTGTGTTGTCTCGCGCGGCGGGTCTGTCTGCATGCTGTAAGGAGGATGCAGTACAC...AGAGGGTCCTGTGTTGAGGCCATGAAGCCAGACCCTAAGCCAGACGGTCTGTCTGAGCACTATGACatt......CACGCTGACATAGCAGCAGTCTGCCAGACCTTTACCAAGACCCCGGATGTAGCCATGGGGAAGTTGGTCTATGAGATCTCAGTGCGTCACCCTGAGTCGTCTCAGCAGGTGATTCTGAGGTTCGCCAAGGAGGCTGAGCAGGCCTTGCTCCAGTGCTGCGAC......ATGGAGGACCACGCAGAGTGTGTC
TRN  10010101100011001
NAM  Q9YGH6_9NEOB/29-201
ASQ  PRIINDIVKAVGKPAVEKLVLVMVAQDFEKCSLDEHLKVQAKIIEAVDNCEKHPEE..AECKKPAIELYHDIVCKEEDIDQLYPWTTECCGKAEAE.RTKCFYEHREVR---VEEYKI-...-PNIEESCKEHKEHPQRAFSYYLSNIAKRHSKLYPPAVLGFAIQYNEITTECCA..AEDKAKCF
DSQ  CCACGGATAATAAACGATATTGTAAAGGCAGTGGGAAAACCAGCTGTTGAAAAATTAGTGTTGGTGATGGTGGCACAGGATTTTGAAAAATGCTCACTGGATGAACATCTGAAAGTCCAGGCAAAAATTATAGAGGCTGTTGATAACTGCGAAAAACATCCAGAGGAA......GCTGAGTGTAAAAAACCAGCGATTGAACTGTATCATGACATAGTTTGCAAAGAAGAAGACATAGACCAGCTCTACCCCTGGACTACAGAGTGTTGTGGCAAAGCGGAGGCAGAG...AGGACCAAGTGCTTTTATGAGCATAGAGAAGTTCGA---------GTTGAGGAATATAAGATA---.........---CCAAATATTGAAGAATCCTGCAAAGAACACAAAGAGCACCCACAACGTGCCTTCTCTTACTACCTCTCCAATATTGCTAAAAGACATTCAAAACTCTATCCACCAGCTGTTCTGGGTTTTGCTATACAATACAATGAAATCACTACTGAATGTTGTGCT......GCAGAAGACAAAGCCAAGTGCTTT
TRN  10010101100011000
NAM  Q91134_NAJNA/31-206
ASQ  QHSTIRLASQISATDFGAITLTLVTQTVPNATLEDLKKLSAEIIELHKKCVASEFS.dPPCTKPLGIVFLDVLCHNEEFSNKYG-INDCCAKADPD.RNECVLSHKTSSTGTISPFVH-...-PNAEEACQAFQNDRDSVLAQYIFELSRRYPTALSVVILESTKTYKKILETCCA..EADKDACI
DSQ  CAACACTCGACCATCAGACTTGCATCTCAAATATCAGCTACTGATTTTGGTGCCATAACCTTAACTTTAGTCACTCAAACTGTACCAAATGCCACACTTGAGGACCTGAAAAAATTGTCAGCAGAAATTATAGAACTTCACAAGAAATGTGTTGCTAGTGAATTTTCA...gacCCACCATGTACAAAGCCTTTGGGTATAGTTTTCCTGGATGTACTCTGCCATAATGAAGAGTTTTCCAACAAATATGGA---ATTAATGACTGTTGTGCTAAGGCTGATCCAGAC...AGAAATGAATGTGTTTTGTCCCATAAAACCTCATCTACAGGAACTATTTCTCCCTTTGTTCAT---.........---CCTAATGCAGAAGAAGCTTGCCAAGCATTTCAGAATGACAGAGATTCTGTTCTAGCCCAATATATTTTTGAGCTGTCCAGAAGATATCCCACAGCACTATCTGTTGTAATCCTTGAATCAACTAAAACCTATAAAAAAATCTTGGAAACTTGCTGTGCA......GAAGCTGATAAAGATGCCTGTATC
TRN  10010101100011000
NAM  ALBU_RABIT/28-202
ASQ  KSEIAHRFNDVGEEHFIGLVLITFSQYLQKCPYEEHAKLVKEVTDLAKACVADESA..ANCDKSLHDIFGDKICALPSLRDTYGDVADCCEKKEPE.RNECFLHHKDDKPD-LPPFAR-...-PEADVLCKAFHDDEKAFFGHYLYEVARRHPYFYAPELLYYAQKYKAILTECCE..AADKGACL
DSQ  AAAAGTGAGATTGCTCATCGGTTTAATGATGTGGGAGAAGAACATTTCATAGGCCTGGTGCTGATTACCTTTTCTCAGTATCTCCAGAAGTGCCCATATGAAGAGCATGCGAAGTTAGTGAAGGAAGTAACAGACTTGGCAAAAGCATGTGTTGCTGATGAGTCAGCA......GCAAATTGTGACAAATCACTTCATGATATTTTTGGAGACAAAATCTGTGCATTGCCAAGTCTTCGTGACACCTATGGTGACGTGGCTGACTGCTGTGAGAAAAAAGAACCTGAG...CGAAACGAATGCTTCCTGCACCACAAGGATGATAAACCCGAC---TTGCCTCCGTTTGCGAGA---.........---CCAGAAGCTGATGTTTTGTGCAAAGCCTTTCATGATGATGAAAAGGCATTCTTTGGACACTATTTATATGAAGTTGCCAGAAGACATCCTTACTTTTATGCCCCTGAACTCCTTTACTATGCTCAGAAGTACAAAGCCATTCTAACAGAATGTTGCGAA......GCTGCTGATAAAGGGGCCTGCCTC
TRN  10010101100011000
NAM  ALBU_MOUSE/28-202
ASQ  KSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESA..ANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPE.RNECFLQHKDDNPS-LPPFER-...-PEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLYYAEQYNEILTQCCA..EADKESCL
DSQ  AAGAGTGAGATCGCCCATCGGTATAATGATTTGGGAGAACAACATTTCAAAGGCCTAGTCCTGATTGCCTTTTCCCAGTATCTCCAGAAATGCTCATACGATGAGCATGCCAAATTAGTGCAGGAAGTAACAGACTTTGCAAAGACGTGTGTTGCCGATGAGTCTGCC......GCCAACTGTGACAAATCCCTTCACACTCTTTTTGGAGATAAGTTGTGTGCCATTCCAAACCTCCGTGAAAACTATGGTGAACTGGCTGACTGCTGTACAAAACAAGAGCCCGAA...AGAAACGAATGTTTCCTGCAACACAAAGATGACAACCCCAGC---CTGCCACCATTTGAAAGG---.........---CCAGAGGCTGAGGCCATGTGCACCTCCTTTAAGGAAAACCCAACCACCTTTATGGGACACTATTTGCATGAAGTTGCCAGAAGACATCCTTATTTCTATGCCCCAGAACTTCTTTACTATGCTGAGCAGTACAATGAGATTCTGACCCAGTGTTGTGCA......GAGGCTGACAAGGAAAGCTGCCTG
TRN  10010101100011000
NAM  ALBU_MERUN/29-203
ASQ  KSEIAHRYKDLGEKYFKGLVLYTFSQYLQKCSYEEHVKLVREVTDFASNCAKDESA..ENCDKSLHTLFGDKLCSLPNFGEKYAEMADCCAKQEPE.RNECFLQHKDDNPQ-LPPFKR-...-AEPDAMCTAFQENAEAFMGHYLHEVARRHPYFYGPELLYLADKYTAVLTECCA..ADDKGACL
DSQ  AAGAGTGAGATCGCTCATCGGTATAAAGATTTGGGAGAAAAATATTTCAAAGGCCTTGTCCTGTACACCTTTTCCCAGTATCTCCAGAAATGCTCCTATGAAGAACATGTCAAATTAGTGAGAGAAGTAACTGACTTTGCAAGCAACTGTGCTAAAGATGAGTCTGCT......GAAAACTGTGACAAATCACTTCACACTCTTTTTGGAGACAAGTTATGCTCTCTACCAAATTTTGGTGAAAAATATGCTGAAATGGCCGACTGCTGTGCAAAACAAGAGCCCGAA...AGAAATGAATGTTTCCTGCAACACAAAGATGACAACCCCCAG---CTGCCCCCATTCAAGAGG---.........---GCGGAGCCTGATGCCATGTGTACTGCCTTCCAGGAAAATGCTGAAGCATTTATGGGACATTACTTGCATGAAGTTGCCAGAAGACATCCTTATTTCTACGGCCCGGAGCTCCTTTACTTGGCTGATAAATACACTGCAGTCCTGACTGAGTGCTGTGCA......GCTGATGACAAAGGAGCCTGCCTG
TRN  10010101100011000
NAM  ALBU_HUMAN/28-202
ASQ  KSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESA..ENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPE.RNECFLQHKDDNPN-LPRLVR-...-PEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQ..AADKAACL
DSQ  AAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCT......GAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAG...AGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAAC---CTCCCCCGATTGGTGAGA---.........---CCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAA......GCTGCTGATAAAGCTGCCTGCCTG
TRN  10010101100011000
NAM  ALBU_HORSE/28-201
ASQ  KSEIAHRFNDLGEKHFKGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKKCAADESA..ENCDKSLHTLFGDKLCTVATLRATYGELADCCEKQEPE.RNECFLTHKDDHPN-LPKLK--...-PEPDAQCAAFQEDPDKFLGKYLYEVARRHPYFYGPELLFHAEEYKADFTECCP..ADDKLACL
DSQ  AAGAGTGAGATTGCTCATCGGTTTAATGATTTGGGAGAAAAACATTTCAAAGGCCTGGTGCTGGTTGCCTTTTCTCAGTATCTCCAGCAGTGCCCATTTGAGGACCACGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAAAATGTGCTGCTGATGAGTCAGCT......GAAAATTGTGACAAGTCACTTCATACTCTTTTTGGAGATAAACTGTGTACAGTTGCAACTCTTCGTGCAACCTACGGTGAACTGGCTGACTGCTGTGAAAAACAAGAACCTGAG...AGAAATGAATGCTTCCTGACACACAAAGATGATCACCCGAAC---CTCCCCAAGCTGAAA------.........---CCAGAACCGGACGCTCAGTGCGCCGCCTTCCAGGAAGATCCAGACAAGTTTCTGGGAAAATACCTGTATGAAGTTGCCAGAAGACATCCTTACTTTTACGGCCCAGAACTACTTTTCCACGCTGAGGAATATAAAGCAGATTTTACAGAATGCTGTCCA......GCTGATGATAAGCTGGCCTGTCTG
TRN  10010101100011000
NAM  ALBU_FELCA/28-202
ASQ  QSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKGCVADQSA..ANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEPE.RNECFLQHKDDNPG-FGQLVT-...-PEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLYYAEEYKGVFTECCE..AADKAACL
DSQ  CAGAGTGAGATTGCTCATCGGTTCAATGATTTGGGAGAAGAACATTTCAGAGGCCTGGTACTGGTTGCCTTTTCTCAGTATCTCCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAGTTCGCAAAAGGATGTGTGGCTGACCAGTCAGCA......GCCAACTGTGAAAAGTCACTTCACGAACTCTTAGGAGATAAACTGTGTACAGTTGCCTCTCTTCGCGACAAGTATGGTGAGATGGCTGATTGCTGTGAGAAAAAAGAACCTGAG...AGAAACGAATGCTTCCTGCAGCACAAAGATGACAATCCCGGC---TTCGGTCAGCTGGTGACC---.........---CCAGAGGCTGATGCCATGTGCACTGCCTTCCACGAAAATGAACAGAGGTTCCTGGGCAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCAGAACTCCTTTACTATGCCGAAGAATACAAAGGAGTTTTTACAGAATGCTGCGAA......GCTGCAGATAAAGCTGCCTGCCTG
TRN  10010101100011000
NAM  ALBU_BOVIN/28-201
ASQ  KSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESH..AGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPE.RNECFLSHKDDSPD-LPKLK--...-PDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQ..AEDKGACL
DSQ  AAGAGTGAGATTGCTCATCGGTTTAAAGATTTGGGAGAAGAACATTTTAAAGGCCTGGTACTGATTGCCTTTTCTCAGTATCTCCAGCAGTGTCCATTTGATGAGCATGTAAAATTAGTGAACGAACTAACTGAGTTTGCAAAAACATGTGTTGCTGATGAGTCCCAT......GCCGGCTGTGAAAAGTCACTTCACACTCTCTTTGGAGATGAATTGTGTAAAGTTGCATCCCTTCGTGAAACCTATGGTGACATGGCTGACTGCTGTGAGAAACAAGAGCCTGAA...AGAAATGAATGCTTCCTGAGCCACAAAGATGATAGCCCAGAC---CTCCCTAAATTGAAA------.........---CCAGACCCCAATACTTTGTGTGATGAGTTTAAGGCAGATGAAAAGAAGTTTTGGGGAAAATACCTATACGAAATTGCTAGAAGACATCCCTACTTTTATGCACCAGAACTCCTTTACTATGCTAATAAATATAATGGAGTTTTTCAAGAATGCTGCCAA......GCTGAAGATAAAGGTGCCTGCCTG
TRN  10010101100011000
NAM  ALBU_PIG/28-201
ASQ  KSEIAHRFKDLGEQYFKGLVLIAFSQHLQQCPYEEHVKLVREVTEFAKTCVADESA..ENCDKSIHTLFGDKLCAIPSLREHYGDLADCCEKEEPE.RNECFLQHKNDNPD-IPKLK--...-PDPVALCADFQEDEQKFWGKYLYEIARRHPYFYAPELLYYAIIYKDVFSECCQ..AADKAACL
DSQ  AAGAGTGAAATTGCTCATCGGTTTAAAGATTTGGGAGAACAATATTTCAAAGGCCTAGTGCTGATTGCCTTTTCTCAGCATCTCCAGCAATGCCCATATGAAGAGCATGTGAAATTAGTGAGGGAAGTAACTGAGTTTGCAAAAACATGTGTTGCTGATGAGTCAGCT......GAAAATTGTGACAAGTCAATTCACACTCTCTTTGGAGATAAATTATGTGCAATTCCATCCCTTCGTGAACACTATGGTGACTTGGCTGACTGCTGTGAAAAAGAAGAGCCTGAG...AGAAACGAATGCTTCCTCCAACACAAAAATGATAACCCCGAC---ATCCCTAAATTGAAA------.........---CCAGACCCTGTTGCTTTATGCGCTGACTTCCAGGAAGATGAACAGAAGTTTTGGGGAAAATACCTATATGAAATTGCCAGAAGACATCCCTATTTCTACGCCCCAGAACTCCTTTATTATGCCATTATATATAAAGATGTTTTTTCAGAATGCTGCCAA......GCTGCTGATAAAGCTGCCTGCCTG
TRN  10010101100011000
NAM  ALBU_CHICK/31-206
ASQ  KSEIAHRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDA..PECSKPLPSIILDEICQVEKLRDSYGAMADCCSKADPE.RNECFLSFKVSQPDFVQPYQR-...-PASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAPAILSFAVDFEHALQSCCK..ESDVGACL
DSQ  AAGAGTGAAATTGCCCATCGCTACAATGATTTGAAAGAAGAAACATTTAAGGCAGTTGCCATGATCACATTTGCCCAGTATCTCCAGAGGTGCTCTTATGAAGGACTGTCTAAGCTTGTGAAGGATGTTGTTGATCTGGCACAAAAATGTGTAGCCAATGAAGATGCT......CCTGAATGCTCAAAACCACTGCCTTCCATTATCCTGGATGAAATCTGCCAAGTGGAAAAGCTCCGTGACTCTTATGGTGCAATGGCCGACTGCTGTAGCAAAGCTGATCCTGAA...AGAAATGAGTGTTTCCTGTCATTTAAAGTTTCCCAACCAGACTTCGTTCAGCCATACCAAAGA---.........---CCAGCTTCTGATGTGATATGCCAGGAATACCAGGACAACAGAGTGTCATTTCTGGGACATTTCATCTATTCTGTTGCAAGAAGACACCCCTTCTTGTATGCCCCTGCAATCCTTAGTTTTGCTGTTGATTTTGAACATGCACTTCAAAGCTGTTGCAAA......GAGAGTGATGTCGGTGCTTGCCTG
TRN  10010101100011001
NAM  ALBU1_XENLA/31-202
ASQ  HKHIADMYNLLTERTFKGLTLAIVSQNLQKCSLEELSKLVNEINDFAKSCTGNDKT..PECEKPIGTLFYDKLCADPKVGVNYEWSKECCSKQDPE.RAQCFRAHRVFEHN---PVR--...-PKPEETCALFKEHPDDLLSAFIHEEARNHPDLYPPAVLLLTQQYGKLVEHCCE..EEDKDKCF
DSQ  CACAAGCATATTGCTGACATGTACAATTTATTGACTGAGCGGACCTTCAAAGGACTTACATTGGCTATTGTCTCACAGAATCTCCAGAAATGTTCATTGGAGGAGCTGTCTAAACTGGTGAATGAAATTAATGACTTTGCCAAATCCTGTACAGGAAACGACAAAACT......CCTGAGTGTGAAAAACCCATAGGCACCCTGTTTTATGACAAACTCTGCGCAGATCCAAAAGTGGGTGTTAATTATGAGTGGAGCAAAGAGTGCTGTTCTAAGCAAGATCCAGAG...AGAGCACAGTGCTTCAGGGCACATAGAGTTTTTGAACATAAT---------CCAGTAAGG------.........---CCTAAACCTGAGGAAACTTGTGCATTATTCAAAGAACACCCTGATGATCTTCTCTCAGCATTCATACATGAAGAGGCGAGAAACCATCCAGACCTTTATCCCCCAGCAGTACTATTATTAACACAGCAATATGGCAAACTTGTTGAACATTGTTGTGAA......GAAGAAGACAAGGATAAATGCTTT
TRN  10010101100011000
NAM  FETA_RAT/34-204
ASQ  IESTLDSSQCPTEKNMFNVATIVVAQFVQDATKAEVNKMSSDALAAMKENTGD---..-GCLENQLSVFLDEICHETELSNKYG-FSGCCNQSGVE.RHQCLLARKKTAPDSVPPFHF-...-PETAESCPAYEENRAMSINTFIYDVSKRNPFLYAPTILYLAAQYDKAVPACCK..ADNMEECF
DSQ  ATAGAATCCACGTTAGACTCTTCCCAATGCCCGACAGAGAAAAATATGTTTAACGTAGCTACCATTGTCGTTGCCCAGTTTGTTCAGGATGCCACAAAGGCCGAAGTAAACAAAATGAGTAGCGATGCGTTGGCTGCAATGAAGGAAAACACTGGCGAT---------......---GGGTGTTTAGAAAACCAGCTATCTGTGTTTCTGGATGAAATTTGCCACGAGACGGAACTCTCTAACAAGTATGGA---TTCTCAGGTTGCTGCAACCAAAGCGGGGTGGAA...AGACACCAGTGTCTGCTGGCTCGCAAGAAGACCGCTCCAGACTCTGTCCCACCCTTCCACTTT---.........---CCAGAAACTGCCGAGAGTTGCCCAGCATACGAAGAAAACAGGGCGATGTCCATAAACACGTTCATCTACGATGTGTCGAAGAGGAACCCCTTCCTGTATGCTCCCACCATTCTTTACTTAGCCGCTCAGTATGACAAGGCAGTTCCAGCATGCTGCAAA......GCTGACAACATGGAGGAATGCTTC
TRN  10010101100011000
NAM  FETA_MOUSE/28-198
ASQ  IASTLDSSQCVTEKNVLSIATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGD---..-GCLESQLSVFLDEICHETELSNKYG-LSGCCSQSGVE.RHQCLLARKKTAPASVPPFQF-...-PEPAESCKAHEENRAVFMNRFIYEVSRRNPFMYAPAILSLAAQYDKVVLACCK..ADNKEECF
DSQ  ATAGCTTCCACGTTAGATTCCTCCCAGTGCGTGACGGAGAAGAATGTGCTTAGCATAGCTACCATCACCTTTACCCAGTTTGTTCCGGAAGCCACCGAGGAGGAAGTGAACAAAATGACTAGCGATGTGTTGGCTGCAATGAAGAAAAACTCTGGCGAT---------......---GGGTGTTTAGAAAGCCAGCTATCTGTGTTTCTGGATGAAATTTGCCATGAGACGGAACTCTCTAACAAGTATGGA---CTCTCAGGCTGCTGCAGCCAAAGTGGAGTGGAA...AGACATCAGTGTCTGCTGGCACGCAAGAAGACTGCTCCGGCCTCTGTCCCACCCTTCCAGTTT---.........---CCAGAACCTGCCGAGAGTTGCAAAGCACATGAAGAAAACAGGGCAGTGTTCATGAACAGGTTCATCTATGAAGTGTCAAGGAGGAACCCCTTCATGTATGCCCCAGCCATTCTGTCCTTGGCTGCTCAGTACGACAAGGTCGTTCTGGCATGCTGCAAA......GCTGACAACAAGGAGGAGTGCTTC
TRN  10010101100011000
NAM  FETA_HORSE/28-202
ASQ  IASALDSFQCSPEMNLVDLATIFFAQFVQEATYKEVSKMVKDVLTVTEKSTGSEQP..TGCSENRLSAFLEEICHEEEIPEKYG-LSGCCSQNEEE.RHNCLLARKKDSPASIPPFQV-...-PEPVTSCKAYEENREMFLNRYLYEIARRHPFLYSSTALYLASHYDKIISACCK..SENAVECF
DSQ  ATAGCTTCCGCACTGGATTCTTTCCAATGTTCTCCAGAGATGAATTTAGTTGACCTAGCCACCATATTTTTTGCCCAGTTTGTTCAAGAGGCCACTTACAAGGAAGTAAGCAAAATGGTGAAAGATGTATTGACTGTAACTGAGAAGTCCACTGGCAGTGAGCAGCCA......ACAGGGTGTTCAGAAAACCGGCTATCTGCCTTCCTGGAAGAAATTTGCCATGAGGAGGAAATTCCTGAAAAGTATGGA---CTTTCAGGTTGCTGCAGCCAAAATGAAGAGGAA...AGACATAACTGTTTACTGGCACGCAAGAAGGACTCTCCAGCATCCATCCCACCCTTCCAAGTT---.........---CCAGAACCTGTCACGAGTTGTAAAGCATATGAAGAAAACAGGGAGATGTTCCTGAACCGATACCTGTATGAGATAGCAAGAAGGCACCCCTTCCTGTATTCATCTACAGCTCTTTATTTGGCTTCTCACTATGACAAAATAATTTCAGCATGCTGCAAA......TCTGAAAATGCAGTTGAATGTTTC
TRN  10010101100011000
NAM  FETA_GORGO/28-202
ASQ  IASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQS..AGCLENQLPAFLEELCHEKEILEKYG-LSDCCSQSEEG.RHNCFLAHKKPTPASIPLFQV-...-PEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCK..AENAVECF
DSQ  ATAGCTTCCATATTGGATTCTTACCAATGTACTGCAGAGATAAGTTTAGCTGACCTGGCTACCATATTTTTTGCCCAGTTTGTTCAAGAAGCCACTTACAAGGAAGTAAGCAAAATGGTGAAAGATGCATTGACTGCAATTGAGAAACCCACTGGAGATGAACAGTCT......GCAGGGTGTTTAGAAAACCAGCTACCTGCCTTTCTGGAAGAACTTTGCCATGAGAAAGAAATTTTGGAGAAGTACGGA---CTTTCAGACTGCTGCAGCCAAAGTGAAGAGGGA...AGACATAACTGTTTTCTTGCACACAAAAAGCCCACTCCAGCATCCATCCCACTTTTCCAAGTT---.........---CCAGAACCTGTCACAAGTTGTGAAGCATATGAAGAAGACAGGGAGACATTCATGAACAAATTCATTTATGAGATAGCAAGAAGGCATCCCTTCCTGTATGCACCTACAATTCTTCTTTGGGCTGCTCGCTATGACAAAATAATTCCATCTTGCTGCAAA......GCTGAAAATGCAGTTGAATGCTTC
TRN  10010101100011000
NAM  AFAM_MOUSE/28-202
ASQ  DVDHFNATQKFIDENTAYLAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTL..PECSKTANDAIQDMLCDMEGLPQKHN-FSHCCGKAGFP.RRLCFFYNKKANVGFLPPFPT-...-LDPEEKCQAYKNKSESFLHLYMYEVARRNPFVFAPVLLAVAAWFEEAATTCCE..QQQKATCF
DSQ  GACGTAGATCATTTCAATGCTACCCAGAAATTCATAGATGAGAACACGGCATACCTGGCCATCATCGCGTTTTCCCAGTATGTCCAGGAAGCATCCTTTGATGAGGTGGAAACGCTGGTGAAAGTCATGCTGGATTACAGGGATAGGTGCTGGGCTGACAACACACTT......CCAGAGTGTTCAAAGACAGCTAATGACGCTATCCAGGACATGTTATGTGACATGGAGGGACTGCCGCAGAAGCACAAC---TTTTCTCATTGCTGCGGGAAAGCCGGCTTTCCA...AGAAGACTCTGTTTCTTCTACAACAAGAAAGCTAATGTAGGATTCTTGCCCCCTTTCCCCACT---.........---CTGGATCCAGAAGAGAAATGCCAAGCTTATAAAAATAAAAGTGAATCTTTTCTACACCTCTATATGTATGAGGTTGCCAGAAGGAACCCCTTTGTCTTCGCCCCCGTTCTTCTAGCCGTGGCTGCTTGGTTTGAGGAGGCAGCGACCACATGTTGTGAA......CAGCAACAGAAAGCCACCTGCTTT
TRN  10010101100011000
NAM  AFAM_HUMAN/28-202
ASQ  DIENFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDMVEYKDRCMADKTL..PECSKLPNNVLQEKICAMEGLPQKHN-FSHCCSKVDAQ.RRLCFFYNKKSDVGFLPPFPT-...-LDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCE..EQNKVNCL
DSQ  GATATAGAGAACTTCAATAGTACTCAAAAATTTATAGAAGATAATATTGAATACATCACCATCATTGCATTTGCTCAGTATGTTCAGGAAGCAACCTTTGAAGAAATGGAAAAGCTGGTGAAAGACATGGTAGAATACAAAGACAGATGTATGGCTGACAAGACGCTC......CCAGAGTGTTCAAAATTACCTAATAATGTTTTACAGGAAAAAATATGTGCTATGGAGGGGCTGCCACAAAAGCATAAT---TTCTCACACTGCTGCAGTAAGGTTGATGCTCAA...AGAAGACTCTGTTTCTTCTATAACAAGAAATCTGATGTGGGATTTCTGCCTCCTTTCCCTACC---.........---CTGGATCCCGAAGAGAAATGCCAGGCTTATGAAAGTAACAGAGAATCCCTTTTAAATCACTTTTTATATGAAGTTGCCAGAAGGAACCCATTTGTCTTCGCCCCTACACTTCTAACTGTTGCTGTTCATTTTGAGGAGGTGGCCAAATCATGTTGTGAA......GAACAAAACAAAGTCAACTGCCTT
TRN  10010101100011000
NAM  ALBU1_SALSA/22-196
ASQ  QNQICTIFTEAKEDGFKSLILVGLAQNLPDSTLGDLVPLIAEALAMGVKCCSDTPP..EDCERDVADLFQSAVCSSETLVEKND-LKMCCEKTAAE.RTHCFVDHKAKIPRDLSLKAE-...-LPAADQCEDFKKDHKAFVGRFIFKFSKSNPMLPPHVVLAIAKGYGEVLTTCCG..EAEAQTCF
DSQ  CAGAACCAGATCTGTACCATCTTCACTGAGGCCAAGGAAGATGGATTCAAATCTTTGATCCTTGTAGGGCTGGCTCAGAATCTTCCCGATAGTACGTTGGGTGACTTGGTGCCTCTCATCGCAGAGGCCTTAGCCATGGGCGTCAAATGCTGCTCAGACACTCCTCCA......GAGGACTGCGAAAGAGATGTGGCGGACCTGTTCCAGAGCGCGGTGTGTTCCTCTGAGACCCTGGTGGAGAAGAACGAT---CTGAAGATGTGCTGTGAGAAGACTGCCGCTGAG...AGGACACACTGCTTCGTGGACCACAAGGCCAAGATTCCTCGGGACCTGTCCCTCAAAGCTGAG---.........---CTGCCCGCTGCAGACCAGTGTGAAGACTTCAAGAAGGACCACAAGGCTTTTGTTGGGAGGTTCATCTTCAAGTTCTCCAAGAGTAACCCGATGCTACCCCCACATGTGGTCCTGGCTATCGCCAAAGGTTATGGAGAGGTTCTGACTACATGCTGTGGA......GAGGCTGAGGCCCAGACCTGCTTC
TRN  10010101100011000
NAM  FETA_MOUSE/408-588
ASQ  SKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCCQLSEEkwSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSN.RRLCITSFLRDETYAPPPFSEDk..FIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLEKCCK..AQDQEVCF
DSQ  TCCAAGCAAAGCTGCGCTCTCTACCAGACCTTAGGAGACTACAAATTACAAAATCTGTTCCTTATTGGTTACACGAGGAAAGCCCCTCAGCTGACCTCAGCAGAGCTGATCGACCTCACCGGGAAGATGGTGAGCATTGCCTCCACGTGCTGCCAGCTCAGCGAGGAGaaatggTCCGGCTGTGGTGAGGGAATGGCCGACATTTTCATTGGACATTTGTGTATAAGGAATGAAGCAAGCCCTGTGAACTCTGGTATCAGCCACTGCTGCAACTCTTCGTATTCCAAC...AGGAGGCTATGCATCACCAGTTTTCTGAGGGATGAAACCTATGCCCCTCCCCCATTCTCTGAGGATaaa......TTCATCTTCCACAAGGATCTGTGCCAAGCTCAGGGCAAAGCCCTACAGACCATGAAACAAGAGCTTCTCATTAACCTGGTGAAGCAAAAGCCTGAACTGACAGAGGAGCAGCTGGCGGCTGTCACTGCAGATTTCTCGGGCCTTTTGGAGAAGTGCTGCAAA......GCCCAGGACCAGGAAGTCTGTTTC
TRN  10010101100011000
NAM  AFAM_MOUSE/412-590
ASQ  VQQECNQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLSDE..FACVDNLADLVLGELCGVNTNRTINPAVDHCCKTDFAF.RRHCFEHLKADTTYALPSVSALv..SALHTDWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEWLCLFTKFTAAREECSE..VQEPESCF
DSQ  GTGCAACAGGAGTGCAACCAGTTCCAGGAGCTGGGGAAGGACACTCTGCAACGCCATTTCCTTGTCAAGTTCACCAAGGCAGCCCCTCAGCTCCCCATGGAAGAACTGGTCTCCCTTAGTAAGGAAATGGTGGCAGCTCTGACAACCTGTTGCACTCTCAGTGACGAG......TTCGCCTGCGTTGACAACTTGGCAGATTTAGTTCTTGGAGAGTTATGTGGGGTAAATACAAATCGAACTATCAATCCTGCTGTGGATCACTGCTGCAAAACAGACTTCGCCTTC...AGAAGACACTGCTTTGAGCATCTGAAAGCTGATACAACGTATGCGCTCCCATCAGTCTCCGCACTTgta......TCTGCTTTGCATACAGACTGGTGTCAGCCTCGTAAGGAGGACCTTCAGAATAAGAAACACAGGTTTCTGGTCAACTTGGTGAAGTGGATGCCAGGGATCACGGATGAGGAGTGGCTGTGCTTGTTCACAAAGTTCACTGCTGCCAGGGAGGAGTGCAGCGAA......GTGCAGGAGCCTGAGTCCTGTTTC
TRN  10010101100011000
NAM  AFAM_HUMAN/412-590
ASQ  VQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEE..FACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAF.RRPCFESLKADKTYVPPPFSQDl..FTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCK..AESPEVCF
DSQ  GTACAACAAGAATGTAAACATTTCCAGAATTTGGGGAAGGATGGTTTGAAATACCATTACCTCATCAGGCTCACGAAGATAGCTCCCCAACTCTCCACTGAAGAACTGGTGTCTCTTGGCGAGAAAATGGTGACAGCTTTCACTACTTGCTGTACGCTAAGTGAAGAG......TTTGCCTGTGTTGATAATTTGGCAGATTTAGTTTTTGGAGAGTTATGTGGAGTAAATGAAAATCGAACTATCAACCCTGCTGTGGACCACTGCTGTAAAACAAACTTTGCCTTC...AGAAGGCCCTGCTTTGAGAGTTTGAAAGCTGATAAAACATATGTGCCTCCACCTTTCTCTCAAGATtta......TTTACCTTTCACGCAGACATGTGTCAATCTCAGAATGAGGAGCTTCAGAGGAAGACAGACAGGTTTCTTGTCAACTTAGTGAAGCTGAAGCATGAACTCACAGATGAAGAGCTGCAGTCTTTGTTTACAAATTTCGCAAATGTAGTGGATAAGTGCTGCAAA......GCAGAGAGTCCTGAAGTCTGCTTT
TRN  10010101100011010
//