EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00265 - TK)
FAM  PF00265
PID  TK
DES  Thymidine kinase
IPR  IPR001267
ANO  13
ALN  191
AID  0.40445
APH  (((((((((KITH_MYXVU/6-176:0.20554,(KITH_CHICK/19-190:0.33679,KITH_MONPV/4-174:0.15476):0.11529):0.08240,KITH_CAPVK/4-174:0.17547):0.06335,KITH_SWPVK/4-175:0.17001):0.18202,KITH_FOWPV/4-180:0.38496):0.10779,KITH_ASFB7/10-183:1.34556):0.04788,(KITH_AMEPV/1-178:0.17509,KITH_CBEPV/1-179:0.28675):0.38273):0.31909,KITH_BACSU/8-187:0.51281):0.99729,KITH_BPT4/2-185:0.42291):0.19558,KITH_ECOLI/2-186:0.22840,KITH_HAEIN/2-186:0.20036);
ATP  (((((((((KITH_MYXVU/6-176,(KITH_CHICK/19-190,KITH_MONPV/4-174)),KITH_CAPVK/4-174),KITH_SWPVK/4-175),KITH_FOWPV/4-180),KITH_ASFB7/10-183),(KITH_AMEPV/1-178,KITH_CBEPV/1-179)),KITH_BACSU/8-187),KITH_BPT4/2-185),KITH_ECOLI/2-186,KITH_HAEIN/2-186);
ATL  7.11
DNO  13
DLN  573
DID  0.489237
DPH  (((((((((KITH_CAPVK/4-174:0.18652,((KITH_AMEPV/1-178:0.15180,KITH_CBEPV/1-179:0.14228):0.27187,KITH_FOWPV/4-180:0.30236):0.10623):0.03915,KITH_SWPVK/4-175:0.19118):0.09272,KITH_MONPV/4-174:0.16898):0.13669,KITH_MYXVU/6-176:0.17901):0.17349,KITH_CHICK/19-190:0.23806):0.18597,KITH_ASFB7/10-183:0.73109):0.17696,KITH_BACSU/8-187:0.34062):0.47129,KITH_BPT4/2-185:0.30634):0.15705,KITH_ECOLI/2-186:0.24512,KITH_HAEIN/2-186:0.20237);
DTP  (((((((((KITH_CAPVK/4-174,((KITH_AMEPV/1-178,KITH_CBEPV/1-179),KITH_FOWPV/4-180)),KITH_SWPVK/4-175),KITH_MONPV/4-174),KITH_MYXVU/6-176),KITH_CHICK/19-190),KITH_ASFB7/10-183),KITH_BACSU/8-187),KITH_BPT4/2-185),KITH_ECOLI/2-186,KITH_HAEIN/2-186);
DTL  5.19715
RID  0.40445
RPH  (((((((((KITH_MYXVU/6-176:0.20554,(KITH_CHICK/19-190:0.33679,KITH_MONPV/4-174:0.15476):0.11529):0.08240,KITH_CAPVK/4-174:0.17547):0.06335,KITH_SWPVK/4-175:0.17001):0.18202,KITH_FOWPV/4-180:0.38496):0.10779,KITH_ASFB7/10-183:1.34556):0.04788,(KITH_AMEPV/1-178:0.17509,KITH_CBEPV/1-179:0.28675):0.38273):0.31909,KITH_BACSU/8-187:0.51281):0.99729,KITH_BPT4/2-185:0.42291):0.19558,KITH_ECOLI/2-186:0.22840,KITH_HAEIN/2-186:0.20036);
RTP  (((((((((KITH_MYXVU/6-176,(KITH_CHICK/19-190,KITH_MONPV/4-174)),KITH_CAPVK/4-174),KITH_SWPVK/4-175),KITH_FOWPV/4-180),KITH_ASFB7/10-183),(KITH_AMEPV/1-178,KITH_CBEPV/1-179)),KITH_BACSU/8-187),KITH_BPT4/2-185),KITH_ECOLI/2-186,KITH_HAEIN/2-186);
RTL  7.11
LNK  KITH_AMEPV/1-178:P28852:D10679
LNK  KITH_ASFB7/10-183:P18555:Z21490
LNK  KITH_BACSU/8-187:Q03221:M97678
LNK  KITH_BPT4/2-185:P13300:X04567
LNK  KITH_CAPVK/4-174:P16600:D00423
LNK  KITH_CBEPV/1-179:Q05879:D10680
LNK  KITH_CHICK/19-190:P04047:K02611
LNK  KITH_ECOLI/2-186:P23331:X51523
LNK  KITH_FOWPV/4-180:P10052:M16617
LNK  KITH_HAEIN/2-186:P44309:U32735
LNK  KITH_MONPV/4-174:P04363:AF380138
LNK  KITH_MYXVU/6-176:P28851:X52655
LNK  KITH_SWPVK/4-175:P23335:M59931
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  KITH_SWPVK/4-175
ASQ  GFIHLILGPMFSGKSTELIRLVNRYQIATYNCRVIKYSKDNRYGND..--AVYTHDKCYISAV----STDSLFDIKDTLDD--VDIVGIDEGQFFN--DIVEFCEYIANKGKIVIVAALDGTYERKPFGNILNLIPLSEKVTKLNAICMICHRD.ASFSKRLS------DEKEIELIGGKEKYLSVCRSCY
DSQ  GGATTTATTCATCTTATATTAGGACCTATGTTCTCTGGAAAGAGTACAGAATTAATTAGGTTAGTAAACCGGTATCAAATAGCCACGTATAATTGTAGAGTTATAAAATATTCTAAAGATAATAGATATGGAAATGAT......------GCGGTATATACACACGATAAATGTTATATATCGGCTGTA------------TCTACGGATTCCTTATTTGATATAAAAGATACACTAGATGAT------GTAGATATTGTTGGAATAGACGAAGGACAATTCTTTAAT------GATATTGTAGAGTTTTGTGAATATATAGCAAATAAAGGAAAAATTGTTATCGTTGCTGCATTAGATGGAACATATGAACGTAAACCATTTGGTAATATTCTTAATCTTATACCATTATCGGAAAAAGTTACTAAATTAAATGCTATATGCATGATATGTCATCGTGAT...GCATCTTTTTCAAAGAGATTAAGC------------------GACGAGAAAGAAATAGAATTGATAGGAGGAAAAGAAAAGTATTTATCGGTATGTCGTTCATGTTAC
TRN  10010101110011000
NAM  KITH_MYXVU/6-176
ASQ  GQIHLIIGPMFAGKSTELIRLVKRYQIARYKCLVVNYEKDARYGNG..---VRTHDNTCISAV----PTASLDDVESISEH--VEVIGIDEGQFFP--NIVSFCERMANAGKVLIVAALDGTFQRKPFTNICELIPLAENVTKLNAVCMYCYKD.ASFSKRLG------NETEIEIIGGSDKYKSVCRKCY
DSQ  GGACAGATTCACCTCATTATAGGACCCATGTTTGCCGGTAAAAGCACGGAACTAATCCGTCTAGTTAAACGTTATCAGATAGCGAGATACAAATGTCTCGTTGTAAATTACGAAAAAGACGCCCGTTACGGAAACGGC......---------GTACGCACTCACGATAACACATGCATCTCCGCCGTA------------CCAACCGCGTCCCTAGACGACGTAGAATCGATATCCGAACAC------GTCGAAGTGATCGGGATAGACGAGGGACAGTTTTTCCCC------AACATCGTATCGTTTTGCGAACGTATGGCGAATGCCGGAAAGGTGTTGATCGTGGCCGCGTTGGACGGAACGTTTCAACGTAAACCGTTTACCAACATTTGTGAACTGATACCGTTGGCCGAAAACGTAACAAAACTGAACGCGGTATGTATGTACTGTTACAAGGAC...GCATCTTTCTCTAAACGGTTGGGA------------------AACGAGACAGAGATCGAAATAATAGGAGGTAGCGACAAGTACAAATCGGTGTGTAGAAAATGTTAT
TRN  10010101100011011
NAM  KITH_CAPVK/4-174
ASQ  GYIHLIIGPMFSGKSTELIRIVKRYQIAQYKCCVVKYLKDIRYGNS..---VYTHDNNHVSAI----STTLLYDVVDKIMN--FDIIGIDEGQFFK--DIVSFSENMANMGKIIIIAALDSTFQRKEFNDILKLIPLSEKVTKLNAVCMECYKD.AAFSKRIT------KEKEIELIGGKEKYKSVCRKCY
DSQ  GGATATATACATTTAATTATAGGACCTATGTTTTCTGGCAAAAGTACTGAATTGATAAGAATAGTTAAAAGGTACCAAATAGCGCAGTATAAATGCTGTGTAGTAAAATACTTAAAAGATATCCGATATGGTAATTCT......---------GTGTATACGCATGATAATAACCATGTATCTGCCATA------------TCAACAACTTTATTATATGACGTCGTTGATAAAATTATGAAT------TTCGACATTATAGGTATAGATGAAGGCCAATTCTTTAAA------GATATTGTATCTTTTTCTGAAAATATGGCAAATATGGGAAAGATAATTATAATAGCTGCACTAGATAGCACGTTTCAACGAAAAGAATTTAATGATATATTGAAATTAATACCGTTATCTGAAAAAGTAACAAAATTAAACGCTGTATGTATGGAATGTTATAAAGAC...GCCGCATTTTCTAAGAGGATCACT------------------AAAGAAAAGGAAATAGAACTCATCGGGGGTAAGGAAAAATATAAATCTGTTTGTAGGAAATGTTAT
TRN  10010101110011000
NAM  KITH_MONPV/4-174
ASQ  GHIQLIIGPMLSGKSTELIRRVRRYQIAQYKCVTIKYSNDNRYGTG..---LWTHDKNNFAAL----EVTKLCDVLEAITD--FSVIGIDEGQFFP--DIVEFCERMANEGKIVIVAALDGTFQRRPFNNILNLIPLSEMVVKLTAVCMKCFKE.ASFSKRLG------AETEIEIIGGNDMYQSVCRKCY
DSQ  GGACATATTCAGTTGATAATCGGCCCCATGCTTTCAGGTAAAAGTACAGAATTAATTAGACGAGTTAGACGTTATCAAATAGCTCAATATAAATGTGTGACTATAAAATATTCTAACGATAATAGATACGGAACGGGA......---------CTATGGACGCATGATAAGAATAATTTTGCAGCATTG------------GAAGTAACTAAACTATGTGATGTCTTGGAAGCAATTACAGAT------TTCTCCGTGATAGGTATCGATGAAGGACAGTTCTTTCCA------GACATTGTTGAATTCTGTGAGCGTATGGCAAACGAAGGAAAAATAGTTATAGTAGCCGCGCTCGATGGGACATTTCAACGTAGACCGTTTAATAATATTTTGAATCTTATTCCATTATCTGAAATGGTGGTAAAACTAACTGCAGTGTGTATGAAATGCTTTAAGGAG...GCTTCCTTTTCTAAACGATTAGGT------------------GCAGAAACCGAGATAGAAATAATAGGAGGTAATGATATGTATCAATCTGTGTGTAGAAAGTGTTAC
TRN  10010101110011000
NAM  KITH_CHICK/19-190
ASQ  GQIQVIFGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTRYCTT..--GVSTHDRNTMEAR----PACALQDVYQEALG--SAVIGIDEGQFFP--DIVEFCEKMANTGKTVIVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYRE.ASYTKRLG------AEREVEVIGGADKYHSVCRACY
DSQ  GGGCAGATCCAGGTGATCTTCGGCCCCATGTTCTCTGGGAAGAGCACTGAGCTCATGCGGCGGGTGCGGCGCTTCCAGCTCGCTCAGTACCGGTGTCTGCTGGTGAAGTACGCCAAGGACACGCGCTACTGCACCACC......------GGCGTCTCCACACATGACAGGAACACCATGGAGGCCCGC------------CCTGCCTGTGCCCTTCAGGATGTGTACCAGGAGGCGCTGGGC------TCTGCGGTCATTGGCATTGACGAGGGGCAGTTTTTCCCA------GATATTGTGGAGTTTTGTGAAAAGATGGCCAACACTGGGAAAACCGTCATCGTTGCTGCTCTTGATGGGACTTTCCAAAGAAAGGCTTTTGGGAGCATCCTCAACCTGGTCCCTCTGGCTGAGAGCGTGGTGAAGCTGAACGCTGTCTGCATGGAGTGCTACCGAGAG...GCCTCCTACACAAAGAGGCTGGGA------------------GCAGAGAGGGAGGTTGAAGTGATTGGAGGAGCAGACAAATACCACTCTGTCTGCCGAGCTTGCTAC
TRN  10010101100011011
NAM  KITH_FOWPV/4-180
ASQ  GSIHVITGPMFSGKTSELVRRIKRFMLSNFKCIIIKHCGDNRYNEDdiNK-VYTHDLLFMEAT----ASSNLSVLVPTLLNDGVQVIGIDEAQFFL--DIVEFSESMANLGKTVIVAALNGDFKRELFGNVYKLLSLAETVSSLTAICVKCYCD.ASFSKRVT------ENKEVMDIGGKDKYIAVCRKCF
DSQ  GGAAGCATCCATGTTATTACAGGCCCTATGTTTTCCGGTAAAACATCGGAGCTAGTAAGAAGAATAAAAAGATTTATGCTATCTAACTTTAAATGTATTATTATTAAACATTGTGGAGATAATAGATATAATGAGGATgatataAACAAA---GTATATACTCATGATCTATTGTTTATGGAGGCTACG------------GCATCTTCTAATCTATCTGTATTAGTACCTACGCTATTAAATGATGGAGTTCAGGTAATAGGTATAGACGAGGCTCAATTCTTTCTA------GACATAGTAGAATTTAGTGAATCCATGGCTAATTTAGGTAAAACAGTTATTGTGGCCGCGCTTAACGGTGATTTTAAACGCGAATTATTCGGTAACGTATATAAGTTATTATCATTAGCTGAAACAGTGTCCAGTTTGACAGCTATTTGCGTGAAATGCTATTGCGAC...GCTTCGTTTTCTAAACGAGTTACA------------------GAAAATAAAGAAGTAATGGATATAGGTGGTAAAGATAAATACATAGCCGTGTGTAGGAAATGTTTT
TRN  10010101110011000
NAM  KITH_CBEPV/1-179
ASQ  MSIEIITGPMYSGKTTELIRRITRYKLCKKNCVIISHSIDNRCEED..DNILINHDGFKISHD-DFIKTNILINKIKIFDK--YEIIGIDECQFFDSNDLMIFCDTLANNGKKIIVAGLNSDFNKNPFKSIIKLIPISEKITKLQSICNFCYND.ATFTMKKF------NKDIIIEIGGSDLYIPVCRICY
DSQ  ATGTCAATAGAAATAATAACAGGCCCCATGTATTCTGGTAAAACTACCGAATTAATTAGAAGAATTACAAGATATAAATTATGTAAAAAAAATTGCGTAATTATATCACATAGTATTGATAATAGATGTGAAGAAGAT......GATAATATTTTAATAAATCATGATGGATTTAAAATATCGCACGAT---GATTTTATAAAAACAAATATATTAATTAATAAAATTAAAATATTTGATAAA------TATGAAATTATAGGCATTGACGAATGTCAATTTTTTGATTCTAATGATTTAATGATATTTTGTGATACATTAGCTAATAATGGAAAAAAAATTATTGTAGCTGGATTAAATAGCGATTTTAATAAAAATCCGTTTAAGTCTATAATAAAATTAATACCCATATCAGAAAAAATAACAAAACTACAATCTATATGTAATTTTTGCTATAATGAT...GCTACGTTTACTATGAAAAAATTT------------------AATAAAGATATAATTATTGAGATAGGTGGTTCAGATTTATATATTCCGGTATGTAGAATATGTTAT
TRN  10010101110011000
NAM  KITH_AMEPV/1-178
ASQ  MSIELIIGPMFSGKTTELMRKINRYILSNQKCVIITHNIDNRFI--..NKNIINHDGNILNKEYLYIKTNNLINEINIVDN--YDIIGIDECQFFEENDLEQFCDKMANNKKKVIVAGLNCDFNRNIFNSISKLIPKVEKIKKLQAICQFCYKD.ASFTIKKH------NKNQIIEIGGQDLYVPVCRLCY
DSQ  ATGTCGATAGAATTAATAATTGGTCCTATGTTTTCTGGCAAAACAACAGAATTGATGCGAAAAATTAATAGATATATTTTATCTAATCAAAAATGTGTAATTATAACTCATAATATAGATAATAGATTTATA------......AATAAAAATATAATAAATCATGACGGAAATATATTAAATAAAGAATATTTATACATTAAAACAAATAATTTAATTAATGAAATCAATATCGTAGATAAT------TATGATATTATTGGCATAGATGAGTGTCAATTTTTTGAAGAAAATGATTTAGAACAATTTTGTGATAAAATGGCTAATAATAAAAAAAAAGTTATTGTTGCTGGATTAAATTGTGACTTTAACAGAAATATATTTAATTCTATATCAAAATTAATTCCTAAAGTAGAAAAAATAAAAAAATTACAAGCTATATGTCAATTTTGTTATAAAGAT...GCTTCTTTTACAATTAAAAAACAT------------------AATAAAAATCAAATAATTGAAATAGGTGGACAAGATTTATATGTTCCTGTGTGTAGATTATGTTAT
TRN  10010101110011000
NAM  KITH_BACSU/8-187
ASQ  GWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEA..--AVVSHNGTSMTSY----AISSAADIWDHISES-TDVVAVDEVQFFD-QEIVEVLSSLADKGYRVIAAGLDMDFRGEPFGVVPNIMAIAESVTKLQAVCSVCGSP.ASRTQRLIDGKPASYDDPVILVGAAESYEARCRHHH
DSQ  GGGTGGCTTGAGCTGATTTGCGGCAGCATGTTCTCGGGGAAATCTGAAGAGCTGATCAGAAGAGTGAAGAGAGCAACTTATGCCAAGCAGGAAGTCAGGGTATTTAAGCCTGTAATTGATAACCGATACAGCGAAGCT......------GCTGTTGTCTCCCATAATGGAACATCGATGACGAGCTAT------------GCCATTTCGTCTGCTGCGGACATTTGGGATCACATCAGTGAAAGT---ACAGATGTGGTTGCGGTTGATGAAGTGCAGTTTTTTGAT---CAGGAAATTGTTGAGGTTTTATCATCTCTTGCCGATAAAGGCTACCGTGTGATAGCAGCAGGCCTTGATATGGATTTTAGGGGAGAGCCGTTCGGTGTCGTCCCGAATATCATGGCGATTGCGGAAAGTGTGACAAAGCTGCAAGCCGTCTGTTCTGTTTGCGGATCACCG...GCGAGCAGAACACAGCGCCTCATTGACGGCAAACCTGCTTCTTACGATGATCCGGTCATTTTGGTTGGTGCAGCTGAATCATATGAAGCAAGATGCAGACATCATCAC
TRN  10010101100011000
NAM  KITH_ASFB7/10-183
ASQ  GTISLVLGPMFAGKTTFLIHCIYMLERLEKKVVFIKSTKNTRDKT-..---IKTHSGIQLRPK--QCKIIESTQLSDVGSLTDIHAVVVDEAHFFD---DLIKCRTWAEEEKIIILAGLNASFEQKMFPPIVRIFPYCSWVKYIGRTCMKCNQHnACFNVRKN------ADKTLILAGGSELYVTCCNNCL
DSQ  GGAACAATTAGCCTTGTGCTGGGACCCATGTTTGCCGGCAAAACTACGTTTCTTATTCATTGCATTTACATGCTCGAACGTTTGGAAAAAAAAGTAGTCTTCATAAAATCTACCAAAAACACCCGAGACAAAACT---......---------ATTAAAACACACTCCGGTATACAGCTACGACCCAAG------CAATGTAAAATCATAGAAAGCACACAGTTATCTGACGTGGGATCTCTCACCGATATCCATGCAGTTGTCGTAGATGAAGCGCATTTTTTTGAC---------GATTTAATAAAATGCCGCACCTGGGCAGAGGAAGAAAAAATTATTATTCTTGCGGGACTCAATGCTTCCTTCGAGCAGAAAATGTTTCCGCCCATCGTTCGTATTTTTCCTTACTGCAGCTGGGTTAAGTATATTGGCCGCACCTGTATGAAATGTAACCAACATaatGCATGCTTTAATGTGCGTAAGAAC------------------GCAGACAAGACGCTTATCCTTGCGGGAGGAAGTGAACTGTACGTAACATGTTGTAACAACTGTCTA
TRN  10010101100011010
NAM  KITH_HAEIN/2-186
ASQ  AKLYFYYSTMNAGKSTTLLQSSYNYRERDMNTLVYTAAIDDRFGVG..--KVTSRIGISQDAFLFRSETNLFDEINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDFQAELFEGSKYLLAWADQLEELKTIC-YCGRK.ANFVLRLNDQGEVIKEGAQIQIGGNDSYLSVCRLHY
DSQ  GCGAAACTCTACTTCTATTACTCCACAATGAACGCTGGAAAATCAACGACGTTGCTACAATCTTCCTATAACTATCGTGAGCGTGATATGAACACATTAGTTTATACGGCTGCGATTGATGATCGTTTTGGCGTGGGA......------AAAGTCACATCGCGTATTGGCATTTCGCAAGATGCCTTTTTATTTCGCTCGGAAACCAATTTGTTTGATGAAATTAATGAGCATTTAAAAAAAGAAAAAGTGCATTGCGTGTTGGTGGATGAAGCTCAATTTCTTAGCAAACAACAAGTTTACCAGTTGAGTGATGTTGTTGATAAACTCAAAATCCCTGTGCTTTGTTATGGCTTGCGTACAGATTTCCAAGCGGAACTTTTTGAAGGAAGTAAATATTTACTGGCTTGGGCGGATCAACTCGAAGAATTAAAAACAATTTGT---TATTGTGGCCGCAAG...GCTAATTTTGTTTTGCGTTTAAATGATCAGGGCGAGGTCATTAAAGAAGGTGCACAAATTCAAATTGGAGGCAATGATTCTTATCTTTCTGTTTGCCGTTTACACTAT
TRN  11011101101011000
NAM  KITH_ECOLI/2-186
ASQ  AQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAG..--KVSSRIGLSSPAKLFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVELKTIC-FCGRK.ASMVLRLDQAGRPYNEGEQVVIGGNERYVSVCRKHY
DSQ  GCACAGCTATATTTCTACTATTCCGCAATGAATGCGGGTAAGTCTACAGCATTGTTGCAATCTTCATACAATTACCAGGAACGCGGCATGCGCACTGTCGTATATACGGCAGAAATTGATGATCGCTTTGGTGCCGGG......------AAAGTCAGTTCGCGTATAGGTTTGTCATCGCCTGCAAAATTATTTAACCAAAATTCATCATTATTTGATGAGATTCGTGCGGAACATGAACAGCAGGCAATTCATTGCGTACTGGTTGATGAATGCCAGTTTTTAACCAGACAACAAGTATATGAATTATCGGAGGTTGTCGATCAACTCGATATACCCGTACTTTGTTATGGTTTACGTACCGATTTTCGAGGTGAATTATTTATTGGCAGCCAATACTTACTGGCATGGTCCGACAAACTGGTTGAATTAAAAACCATCTGT---TTTTGTGGCCGTAAA...GCAAGCATGGTGCTGCGTCTTGATCAAGCAGGCAGACCTTATAACGAAGGTGAGCAGGTGGTAATTGGTGGTAATGAACGATACGTTTCTGTATGCCGTAAACACTAT
TRN  10010101100011000
NAM  KITH_BPT4/2-185
ASQ  ASLIFTYAAMNAGKSASLLIAAHNYKERGMSVLVLKPAIDTRDSVC..--EVVSRIGIKQEANIITDDMDIFEFYKWAEAQKDIHCVFVDEAQFLKTEQVHQLSRIVDTYNVPVMAYGLRTDFAGKLFEGSKELLAIADKLIELKAVC-HCGKK.AIMTARLMEDGTPVKEGNQICIG-DEIYVSLCRKHW
DSQ  GCGAGTTTAATTTTTACTTATGCAGCAATGAATGCTGGAAAATCTGCTTCTCTTTTGATTGCTGCACATAATTATAAAGAACGTGGAATGAGTGTATTAGTTCTTAAGCCTGCTATTGATACTCGCGATTCTGTCTGT......------GAAGTCGTTTCTCGCATTGGAATTAAGCAGGAAGCGAATATTATTACAGATGATATGGATATTTTCGAGTTCTATAAATGGGCTGAAGCACAAAAAGATATTCATTGCGTATTTGTAGATGAAGCTCAGTTTTTAAAAACTGAACAGGTGCATCAATTGAGCCGAATTGTTGATACATATAATGTTCCTGTTATGGCTTATGGGCTAAGGACTGATTTCGCTGGAAAATTATTTGAAGGTTCTAAAGAACTTTTAGCGATTGCAGATAAACTTATTGAACTAAAAGCAGTTTGT---CATTGTGGTAAAAAA...GCGATTATGACAGCTCGATTAATGGAAGATGGAACACCAGTTAAAGAAGGTAATCAAATTTGTATTGGT---GATGAAATTTATGTTTCTTTGTGTAGAAAACATTGG
TRN  10010101110011010
//